GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 15:24:26, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_059282026             757 bp    mRNA    linear   ROD 31-AUG-2023
DEFINITION  PREDICTED: Peromyscus eremicus cysteine-rich secretory protein
            1-like (LOC131926522), mRNA.
ACCESSION   XM_059282026
VERSION     XM_059282026.1
DBLINK      BioProject: PRJNA1009129
KEYWORDS    RefSeq.
SOURCE      Peromyscus eremicus (cactus mouse)
  ORGANISM  Peromyscus eremicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Neotominae; Peromyscus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081432) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_949786415.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/26/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..757
                     /organism="Peromyscus eremicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:42410"
                     /chromosome="16_21"
     gene            1..757
                     /gene="LOC131926522"
                     /note="cysteine-rich secretory protein 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:131926522"
     CDS             1..735
                     /gene="LOC131926522"
                     /codon_start=1
                     /product="cysteine-rich secretory protein 1-like"
                     /protein_id="XP_059138009.1"
                     /db_xref="GeneID:131926522"
                     /translation="
MTLFPLLLFLTAVLPPSLLQDGYENENLENLSTTRKSVQEEIVNKHNQLRRMVSPPGSDLLKMQWSDDARVNAQRWASQCTYKHSPPETRTTKIRCGENIFMSSHPASWSRAIQRWYDEVNDFSFGSGPNKPDAVVGHYTQVVWNTSFQVACGVAECPDQSLKFFYVCHYCPPGNFVGRQYVPYTVGEPCALCPDHCDDGLCTNSCEYEDHYSNCADLKASVTCDYPMVKQNCNATCKCEGKIH"
     polyA_site      757
                     /gene="LOC131926522"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
atgacattatttccactgttgttgttcctgactgctgtgttacccccatcccttcttcaagatggctatgagaatgaaaatcttgagaatttgtcaaccactagaaagtcagtccaagaagagattgtgaacaagcacaaccaactgagaagaatggtttctccacctggtagtgacttactaaagatgcaatggagcgatgatgcccgagtgaatgcgcagagatgggcaagccagtgcacttataaacacagtcctccagaaaccaggaccaccaagataagatgtggtgagaatatcttcatgtcaagtcacccagcatcatggtctcgtgcaatccaaaggtggtatgatgaagtcaatgatttcagttttggttcaggtccaaataaacctgatgcagtagttggacattatactcaggttgtttggaatacatctttccaagttgcatgtggagttgctgagtgccctgaccagtcattgaaattcttttatgtttgtcactattgtcctcctggtaattttgtaggaaggcaatacgttccttacacagtgggagaaccttgtgccctttgtcctgatcactgtgacgatggactatgcacaaatagttgtgaatatgaagatcactattctaactgtgcggatttgaaggcttcagtaacctgtgactatccaatggttaaacaaaactgtaatgctacatgcaaatgtgaaggcaaaattcattaaacatccagtacaaatgaacagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]