ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-10 23:20:03, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_055088696 2558 bp mRNA linear MAM 10-JAN-2025 DEFINITION PREDICTED: Physeter macrocephalus dicer 1, ribonuclease III (DICER1), transcript variant X4, mRNA. ACCESSION XM_055088696 VERSION XM_055088696.1 DBLINK BioProject: PRJNA434122 KEYWORDS RefSeq. SOURCE Physeter macrocephalus (sperm whale) ORGANISM Physeter macrocephalus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Physeteridae; Physeter. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041224.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_002837175.3-RS_2025_01 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/08/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2558 /organism="Physeter macrocephalus" /mol_type="mRNA" /isolate="SW-GA" /db_xref="taxon:9755" /chromosome="11" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..2558 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins" /db_xref="GeneID:102977906" CDS 1179..2558 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_054944671.1" /db_xref="GeneID:102977906" /translation="
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVSASWTKEKWNQEFTKHQVLVMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"
misc_feature 1302..1895
/gene="DICER1"
/note="DEXH-box helicase domain of endoribonuclease Dicer;
Region: DEXHc_dicer; cd18034"
/db_xref="CDD:350792"
misc_feature order(1302..1313,1320..1322,1371..1394,1515..1517,
1704..1706,1797..1799)
/gene="DICER1"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:350792"
misc_feature order(1479..1484,1551..1556,1629..1631,1635..1640,
1647..1649,1722..1730)
/gene="DICER1"
/note="nucleic acid binding site [nucleotide binding];
other site"
/db_xref="CDD:350792"
misc_feature 1989..2273
/gene="DICER1"
/note="Partner-binding domain of the endoribonuclease
Dicer; Region: Dicer_PBD; cd15903"
/db_xref="CDD:277191"
misc_feature order(2004..2009,2016..2018,2022..2027,2202..2207,
2214..2219,2226..2228,2235..2240,2247..2249)
/gene="DICER1"
/note="Trbp binding interface [polypeptide binding]; other
site"
/db_xref="CDD:277191"
misc_feature 2292..>2555
/gene="DICER1"
/note="Members of the P-loop NTPase domain superfamily are
characterized by a conserved nucleotide phosphate-binding
motif, also referred to as the Walker A motif
(GxxxxGK[S/T], where x is any residue), and the Walker B
motif (hhhh[D/E], where h is a...; Region: P-loop
containing Nucleoside Triphosphate Hydrolases; cl38936"
/db_xref="CDD:476819"
ORIGIN
ttttagccagtcacttactggatctctgtattttaattcacagctgcaagataaaatacacggttctgacctatgcaaatgaacaatttacataaatggggccgctgcccccatctcattttctggttatccctgttccggggtggggctgtggggtgggattagttgtctccccagatgcggagggccctggaccactaatgcaggggaaaagcaggcgagggggacggtcctttaaaaaaggtgcgggggcggcgaaaggaaagccgagccctgcgcacaacaattacgaccatggagaagggcctcgtttagggggccgtgggtgccagaaggggcaagaatggaggcggacgaattccgagagccagcagattctgccgactcaagcgagcgtccgcaaccccggcggcgcgcgggcccgggatggtggcgaaggtgcccagcggcgggccgtgtaacgtccggatcccgccccggctctgggccgcaaacacctcctgggcctctgccgctcgcgtccactgtctcccggctcctgagtggctggggggccgggattaacctttcaccgccgcgctctgtccaatcacaggctcgctctcatgccggcgcggggcgagtggagcgtgggggcgcggagggggcggtgcgggcgccgttgggattctccaagccgctgtgcgccgttgccgcaggccgtgcgcgggctgagggcgagcagggcgctgcgcagtctccgcaagcgccggcgggaggggtcgcggcggaggcgcggcgcagcgcggcgcaggctgcttcaggcccaggtgaatggagtaacctgacagcggggacgaggcgacggcgagcgggaggaaatggcggcggcggtggcggcgccgggcggcaccgggaggcctgggctgtgacgcgcgcgccggagcggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagcagaagcttgggtatgctgtgattttccaataaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaagacgtaagctgtgctagaacaaaaatgcaatgaaagaaacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataataccatagtctgtttaaacactggctcagggaagacgtttattgcagtactactcactaaagagctgtcctatcagatcaggggagacttcaacagaaatggcaaaaggacggtgttcttggtcaactctgcaaaccaggttgctcaacaagtgtcagctgtcagaactcactcagatctcaaggttggggaatactcaaacctggaagtaagtgcatcttggacaaaagagaaatggaaccaagagtttactaagcaccaggttctcgttatgacttgctatgtcgccttgaatgttttgaaaaatggttacttatcactatcagacatcaaccttttggtgttcgatgagtgtcatcttgcaatcctagaccacccctaccgagaaattatgaagctctgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaagaaaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacttggtggtcttagacagatatacttcccagccatgtgagattgtggtagactgtggaccatttactgacagaagtggcctttatgaaagactgctgatggaattagaagaagcacttaattttatcaatgactgtaacatatctgtacattcaaaggaaagagattctactttaatttctaaacagatactctcagactgtcgtgcggtattggtagttctgggaccctggtgtgcagataaagtagctggaatgatggtaagagaactacagaaatatatcaaacacgaacaagaggagctgcacaggaaatttctattgtttacagacactttcctaaggaaaatccatgcactatgtgaagagcacttctcacctgcctcacttgacctgaaatttgtaactcctaaagtaataaaactgcttgaaatcttacgcaaatataaaccttatgagcgacagcagtttgaaagcgttgagtggtataataataggaatcaggataattacgtgtcttggagtgattctgaggatgatgaggaggatgaagaaattgaagaaaaagaaaagccagagacaaattttccttctccatttaccaatattttgtgtggaattatttttgtggaaagaagatatacggcagttgtcttaaacaggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]