ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-10 23:44:20, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_055080245 255 bp mRNA linear MAM 10-JAN-2025
DEFINITION PREDICTED: Physeter macrocephalus non-histone chromosomal protein
HMG-14-like (LOC102973125), mRNA.
ACCESSION XM_055080245
VERSION XM_055080245.1
DBLINK BioProject: PRJNA434122
KEYWORDS RefSeq.
SOURCE Physeter macrocephalus (sperm whale)
ORGANISM Physeter macrocephalus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
Cetacea; Odontoceti; Physeteridae; Physeter.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_041231.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Updated annotation
Annotation Name :: GCF_002837175.3-RS_2025_01
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.3
Annotation Method :: Best-placed RefSeq; Gnomon;
cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 01/08/2025
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..255
/organism="Physeter macrocephalus"
/mol_type="mRNA"
/isolate="SW-GA"
/db_xref="taxon:9755"
/chromosome="18"
/sex="female"
/tissue_type="muscle"
/dev_stage="adult"
gene 1..255
/gene="LOC102973125"
/note="non-histone chromosomal protein HMG-14-like;
Derived by automated computational analysis using gene
prediction method: Gnomon. Supporting evidence includes
similarity to: 20 Proteins"
/db_xref="GeneID:102973125"
CDS 1..255
/gene="LOC102973125"
/codon_start=1
/product="non-histone chromosomal protein HMG-14-like"
/protein_id="XP_054936220.1"
/db_xref="GeneID:102973125"
/translation="
MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN"
misc_feature 4..252
/gene="LOC102973125"
/note="HMG14 and HMG17; Region: HMG14_17; pfam01101"
/db_xref="CDD:460064"
ORIGIN
atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]