2024-05-05 21:32:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_054953827 565 bp mRNA linear PLN 05-APR-2023 DEFINITION PREDICTED: Prosopis cineraria uncharacterized LOC129311497 (LOC129311497), mRNA. ACCESSION XM_054953827 VERSION XM_054953827.1 DBLINK BioProject: PRJNA948452 KEYWORDS RefSeq; includes ab initio. SOURCE Prosopis cineraria ORGANISM Prosopis cineraria Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Caesalpinioideae; mimosoid clade; Mimoseae; Prosopis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026555336) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029017545.1-RS_2023_03 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 03/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..565 /organism="Prosopis cineraria" /mol_type="mRNA" /cultivar="Desert tree" /isolate="PC_DT_omini" /db_xref="taxon:364024" /chromosome="Unknown" /tissue_type="leaf" /country="United Arab Emirates: Abu Dhabi" gene 1..565 /gene="LOC129311497" /note="uncharacterized LOC129311497; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:129311497" CDS 80..565 /gene="LOC129311497" /codon_start=1 /product="uncharacterized protein LOC129311497" /protein_id="XP_054809802.1" /db_xref="GeneID:129311497" /translation="
MKRAKPKSHSKTSNHSHNSSPSLKSFIEPPPDFFPSKHEFLRLIVVLAFASAVAWTCNLFLTSFINPSTKPFCDSNVDFPDSFSDDCEPCPSNGACYDGKLECLQGYRKHGKLCVEDGDINKSAKKISDRVKCSLCEDYAQYLCYGVGSVWVQEDEIWKTF"
misc_feature 314..>511 /gene="LOC129311497" /note="Man1-Src1p-C-terminal domain; Region: MSC; pfam09402" /db_xref="CDD:430586" ORIGIN
aacagcagcaaacaagggtgccgtaaaaggcggtctgagcatcccgctcggccggacacatcactctgatctcttccaaatgaagcgcgcaaaacccaagtcccattccaaaacttcaaatcattctcacaattcttctccttctttgaaatcgttcatagaaccccctcctgatttctttccctcgaagcacgagttcctcaggctcatcgtcgtccttgcattcgcatcagcagttgcttggacatgcaatctcttcttgacatcttttattaatccctccaccaagcccttttgcgatagcaacgtagactttccggattcattttccgatgattgtgaaccttgtccaagtaatggagcatgttacgatggcaaattggaatgtctccagggctaccgaaagcatgggaagttgtgtgtagaagatggagatattaataaatcagctaaaaaaatttcggacagagtaaaatgtagcctatgtgaagattatgctcagtatttgtgctatggagtcggatcagtttgggttcaagaggatgaaatatggaaaactttttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]