GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-10-06 02:21:12, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_051966658             447 bp    mRNA    linear   MAM 26-FEB-2023
DEFINITION  PREDICTED: Antechinus flavipes dr1-associated corepressor-like
            (LOC127541369), mRNA.
ACCESSION   XM_051966658
VERSION     XM_051966658.1
DBLINK      BioProject: PRJNA769689
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Antechinus flavipes (yellow-footed antechinus)
  ORGANISM  Antechinus flavipes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Antechinus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_067403) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_016432865.1-RS_2023_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/25/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Antechinus flavipes"
                     /mol_type="mRNA"
                     /isolate="AdamAnt"
                     /db_xref="taxon:38775"
                     /chromosome="6"
                     /sex="male"
                     /tissue_type="testis"
                     /dev_stage="adult"
                     /ecotype="Samford, QLD, Australia"
                     /geo_loc_name="Australia:Samford, QLD"
                     /lat_lon="27.3666667 S 152.86666666 E"
     gene            1..447
                     /gene="LOC127541369"
                     /note="dr1-associated corepressor-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:127541369"
     CDS             1..447
                     /gene="LOC127541369"
                     /codon_start=1
                     /product="dr1-associated corepressor-like"
                     /protein_id="XP_051822618.1"
                     /db_xref="GeneID:127541369"
                     /translation="
MAGKRKYKAHSPQVKIKIIETDEEIGKIETLPVMISWALGLFLNHYKRKLVSFKCQDLCLLPTRASVPFFEGSVGFGTRHAGRWKNQSCNWGKRCLRVSEVQKQQEKNGGTGRKEKGEESGMNWKQEDECEDIETDEEEISQLPHQSS"
     misc_feature    22..>129
                     /gene="LOC127541369"
                     /note="histone fold domain (HFD) superfamily; Region:
                     HFD_SF; cl45933"
                     /db_xref="CDD:480273"
ORIGIN      
atggcaggcaagaggaaatacaaagcccattctccccaagtcaaaatcaagatcatagagacagatgaggagattggcaagattgaaactttacctgtcatgatatcctgggcattaggactgtttttgaatcactacaaaagaaagctggtcagttttaaatgccaggacctgtgcctgcttcccaccagagcatcagttcccttttttgaaggttcagttggctttgggactcgccatgcagggagatggaaaaatcaatcctgtaactgggggaaaagatgccttagggtttcagaagtccagaagcaacaagaaaaaaatggtggtacaggaagaaaggagaaaggtgaagaatctgggatgaactggaagcaggaggatgagtgtgaagacatagaaacagatgaggaagaaatatcacagcttccacaccaatccagttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]