2024-03-30 00:30:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_047352943 2050 bp mRNA linear VRT 03-APR-2022 DEFINITION PREDICTED: Girardinichthys multiradiatus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_047352943 VERSION XM_047352943.1 DBLINK BioProject: PRJNA821872 KEYWORDS RefSeq. SOURCE Girardinichthys multiradiatus ORGANISM Girardinichthys multiradiatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes; Goodeidae; Girardinichthys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_061815) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Girardinichthys multiradiatus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2050 /organism="Girardinichthys multiradiatus" /mol_type="mRNA" /isolate="DD_20200921_A" /db_xref="taxon:208333" /chromosome="23" /sex="male" /tissue_type="mix of soft organs" /dev_stage="adult" gene 1..2050 /gene="vimr2" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns" /db_xref="GeneID:124860001" CDS 24..1184 /gene="vimr2" /codon_start=1 /product="low molecular weight neuronal intermediate filament" /protein_id="XP_047208899.1" /db_xref="GeneID:124860001" /translation="
MAMLRVSSYRKLFEDNRWSPNGGSRLQRAGLYRASGRRAAVDRSVCDKLDFGATSALNKEGLDRFVQDRTTIAALNDRLVKLIELAHCLEEENNSLECQITDLEENLNGQHASPSITPTVAMAECSLEAVVERLHKQRDEIVCDTEELKEELECLHKEYEKAVHQRVLVQQGQQNVAEVVDAVTAECLALREQVAVYEEQLANMETQHKMEVESLLQPDERALATAAIRFGSPDITPALDVKEYHCQLAESLQMEFGTPACGEGDGKKMEMGQTDGSVVKDPTEITDVDEVKALISELQKELNELEKNNEELLDEVEVKRDAYMDEVAELEFTITEMKQQKADLKSQMKEQCQEYKELLTEKMARGMEIAAYRSLVEEEEVRLCSL"
misc_feature 36..233 /gene="vimr2" /note="Intermediate filament head (DNA binding) region; Region: Filament_head; pfam04732" /db_xref="CDD:428095" misc_feature 222..1169 /gene="vimr2" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:425436" polyA_site 2050 /gene="vimr2" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
gaatcctgaactgatccggagccatggccatgctcagagtgtcttcttaccgcaagctgtttgaggacaaccggtggagtccaaacggagggtcgaggttgcagcgtgcaggactttatcgggcctctggcaggcgtgcagctgttgacaggtctgtctgtgataaattagacttcggagcaaccagtgctctgaacaaagagggtctggaccggtttgtccaggaccggaccaccatcgctgcccttaacgaccgcctggtcaaacttattgagttggctcattgtttggaggaagagaataactctcttgaatgccagatcactgacctggaggaaaatctgaacggtcaacacgcctcccccagcatcacccccactgtagcaatggcagagtgcagtttggaagccgtggtggaaagactacacaaacagagggatgagattgtttgtgacacagaggaactgaaggaagagcttgaatgtctacataaagagtacgagaaggctgtacatcagagggtcctcgtacagcaggggcaacaaaatgttgcagaggtggtagatgctgtgacagcagagtgtttggcgctgagggagcaagtggctgtctacgaggaacagctggccaacatggagacccagcacaagatggaagtggagagcctgctgcagccagatgaaagggctctggctacagctgcgattaggtttggcagccctgacatcactccagccttggatgtaaaggagtaccactgccagctggcagagagcctccagatggagtttgggacacccgcctgtggtgaaggtgatggaaagaaaatggaaatgggacaaactgatgggtcagtggtcaaagacccaacggagataaccgatgtggacgaggtgaaggctctgatttcagagctgcagaaggagcttaatgagcttgagaagaataatgaggagttgctggatgaagttgaggtgaagagggatgcttacatggatgaggttgcagagttagagtttactataacagaaatgaagcagcagaaggctgacctcaaatcccagatgaaagagcagtgccaggagtacaaggagctgcttactgagaagatggcaagaggcatggagatcgcggcctacaggagtctggtggaggaagaggaggtgagactgtgcagcctgtgacttggactgatcagatggatttctgctggattctcccctgacacatggattagaaaacagaccaaaaaacatgagaaactgacccaaaatgagcaccagtgtaccagttctagccggtgtttgcttatcatgacggattcatgctgtctggaggactgagccatgccgctgatagcaggtcgaatgcagatgacctggagcctcccaggaaagatggaactgtctgaaacttgttggaggctcagggcttcagtgtctggcactgatatttccttaagtggggtttatctcctccagctcgctgattcataaatgtttgttccctttttgtaaaacaagattcacttaaacgcagacactcaccaagttaggtatcacagagccactcctgctctgatcccacctcgtccgtcaatcaaactccgtctgattaccacctcttaacctttgaccctctcgctgtaatcaaacacactgacaggctcctcctcagtcactgaaagcgtcccaccttgcttttgtttttacagtcatgtgttcatactggtttttaaaagtcaactgctcaacgcaccgtgtttgctttgcaaatggctcgtgaagttgtttttgtgcaaccttctctaaatgagcacctgcatctttccacaagaaaactctgagtgattcattatttcctctttgaaaagcactgtcccaatttgatgtcatttcatgaataagtgtttggtaatgcattcctcactaattttttccttactgtcaacattgcatcaaagctgcctgctatcaatcatccgcctctggccaagcattaaaatgtacttgggattcagattaaataaaactagttgcttgaaaaatca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]