GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-18 17:48:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_042070776             713 bp    mRNA    linear   VRT 14-JUN-2021
DEFINITION  PREDICTED: Alosa sapidissima cold-inducible RNA-binding protein
            B-like (LOC121690282), transcript variant X2, mRNA.
ACCESSION   XM_042070776
VERSION     XM_042070776.1
DBLINK      BioProject: PRJNA736150
KEYWORDS    RefSeq.
SOURCE      Alosa sapidissima (American shad)
  ORGANISM  Alosa sapidissima
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Clupei; Clupeiformes;
            Clupeoidei; Clupeidae; Alosa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_055974.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Alosa sapidissima Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..713
                     /organism="Alosa sapidissima"
                     /mol_type="mRNA"
                     /isolate="fAloSap1"
                     /specimen_voucher="AsapiF_1"
                     /db_xref="taxon:34773"
                     /chromosome="18"
                     /sex="male"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /country="USA: St. Johns River, Florida"
                     /lat_lon="28.438892 N 81.894728 W"
                     /collection_date="2020-02-07"
                     /collected_by="Reid Hyle"
     gene            1..713
                     /gene="LOC121690282"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 16 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:121690282"
     CDS             77..421
                     /gene="LOC121690282"
                     /codon_start=1
                     /product="cold-inducible RNA-binding protein B-like
                     isoform X2"
                     /protein_id="XP_041926710.1"
                     /db_xref="GeneID:121690282"
                     /translation="
MSDEGKLFVGGLSFDTTEQSLEEAFTKFGVITNVHVARNRDTQQSRGFGFVTFDNPDDAKEAMDGMNGQSVDGRTIRVDKAGKPGGGGGGGGGYRGGGGGGYGGGGYGGGGGGW"
     misc_feature    89..325
                     /gene="LOC121690282"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:450164"
     polyA_site      713
                     /gene="LOC121690282"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
tcacgagccccggattgaggcgcacatcacgaagaacagcctttgctcttcagcacacgaggcgtacagcagcaaaatgtctgacgagggaaaactgttcgtcggtggacttagcttcgacacaacggagcagtcccttgaagaagctttcactaagtttggggttatcacaaacgttcacgttgccagaaatcgggacactcagcaatcgcgtggctttggtttcgtcacattcgataacccggacgatgcaaaagaggccatggatggaatgaatggacagtctgtcgacggcagaacgatccgcgtggacaaggccggaaagcctggtggtggcggaggcggcggcggcggctaccgtggcggcggaggcggtggatacggcggtggcggatacggcggcggcggaggaggctggtgatcgtggataggccctaatgctgaccaaaaacatccaggcacatcttactgcaccgcagcgcaacctttaaagcaggatgcagtaagaagaacgctgaccaatctcttcttggactgtaatacacataactccgcgtaagcgtccctggataaataaattaatcttgtaaatgagatgcttgttcttcaaacgttcctcagggatcacattttccatgaacaggaaatgagccctggtctgttatataatgcaatgtgatgtgaaaatggatcaaaataaatactaaaagtta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]