LOCUS       XM_039840780            1093 bp    mRNA    linear   MAM 16-DEC-2025
DEFINITION  PREDICTED: Pteropus medius copper chaperone for superoxide
            dismutase (CCS), mRNA.
ACCESSION   XM_039840780
VERSION     XM_039840780.1
DBLINK      BioProject: PRJNA703023
KEYWORDS    RefSeq.
SOURCE      Pteropus medius (Indian flying fox)
  ORGANISM  Pteropus medius
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yinpterochiroptera;
            Pteropodoidea; Pteropodidae; Pteropodinae; Pteropus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024350923.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_902729225.1-RS_2025_12
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/12/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1093
                     /organism="Pteropus medius"
                     /mol_type="mRNA"
                     /isolation_source="ENVO:00010625"
                     /db_xref="taxon:143291"
                     /chromosome="Unknown"
     gene            1..1093
                     /gene="CCS"
                     /note="copper chaperone for superoxide dismutase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 mRNAs, 15 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     104 samples with support for all annotated introns"
                     /db_xref="GeneID:120584793"
     CDS             117..941
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase"
                     /protein_id="XP_039696714.1"
                     /db_xref="GeneID:120584793"
                     /translation="

MASDSGDRGTACTLEFAVQMTCQSCVDAVRKSLQGVAGIHGVEVQLENQMVLLQTTLPSQEVQALLEGTGRQAVLKGMGSDLLQNLGAAVAILGGPGPVQGVVRFLQLAPERCLIEGTIDGLEPGLHGLHVHQFGDLTKNCNSCGDHFNPDGTSHGGPQDAHRHRGDLGNVRADADGRANFRIEDEQLKIWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKSLACGIIARSAGLFQNSKQICSCDGLTIWEERGRPIAGEGRKEPAQPPAHL"

     misc_feature    156..875
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      

acctggaggcgaggcgaaggccggctttcgaggctccgcctcttcgcgacactgtcctaggtttgcgttgcaggtttctagcagttcgggtccttcctccagtgactgggtccgagatggcatcggattcgggggaccgtgggaccgcctgcacgctggagtttgcagtgcagatgacctgtcagagctgcgtggacgcggtgcgcaagtccctgcaaggggtggcaggtatccacggtgtggaggtgcagttggagaaccagatggtcctgctgcagaccaccctgcccagccaggaagtgcaggccctcctggaaggcactgggcggcaggcggtgctcaagggcatgggcagtgacttactgcagaatctgggggcagcagtggccattctggggggacctggccctgtgcagggggtggtacgcttcctacagctagcccctgagcgctgcctcatcgaggggaccattgatggcctggagcctgggcttcacggactacatgtccaccagtttggggacctcacaaagaactgcaacagctgtggggaccactttaaccctgatggaacgtctcatgggggcccgcaggatgctcaccggcaccggggagacctggggaacgtccgtgcggatgctgacggccgagccaacttcaggatagaggacgagcagctaaagatatgggatgtgattggtcgaagcctggtcatcgatgagggagaagacgacctgggccggggtggccatcccttatccaagatcacagggaactcaggaaagagtttggcctgtggcatcatcgcacgctccgctggcctcttccagaactccaagcagatctgctcctgcgacggcctcaccatctgggaggagcgaggccggcccattgctggcgaggggcgaaaggagccggcccagccccctgcccacctatgagtgtggcctcagcctcgagtctcttactgctcccagtgaaagtgtgccgtccacttctgggggtgaggagagggaggagaactaggatatggggtgtgcaggggtggctgtgatgctcccttggcaaattaaagttttattttcatatggaa

//