2025-04-04 14:04:21, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_038101673 435 bp mRNA linear INV 10-DEC-2020 DEFINITION PREDICTED: Teleopsis dalmanni uncharacterized protein PF11_0213-like (LOC119687384), mRNA. ACCESSION XM_038101673 VERSION XM_038101673.1 DBLINK BioProject: PRJNA682940 KEYWORDS RefSeq; includes ab initio. SOURCE Teleopsis dalmanni (Cyrtodiopsis dalmanii) ORGANISM Teleopsis dalmanni Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Diopsoidea; Diopsidae; Teleopsis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051848.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Teleopsis dalmanni Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..435 /organism="Teleopsis dalmanni" /mol_type="mRNA" /isolate="2A" /isolation_source="laboratory" /db_xref="taxon:139649" /chromosome="X" /sex="female" /geo_loc_name="USA: Maryland" /lat_lon="38.99 N 76.94 W" /collection_date="Sep-2011/Oct-2014" gene 1..435 /gene="LOC119687384" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:119687384" CDS 1..435 /gene="LOC119687384" /codon_start=1 /product="uncharacterized protein PF11_0213-like" /protein_id="XP_037957601.1" /db_xref="GeneID:119687384" /translation="
MYIRTSRFHDSREDHNDLEHLENLKDFEGLEDYEDYENHEYLEYFEVLEFLEDRGNLEVPKYHKNLEDLEKVEDLKHHEDFKNVNELKNLEKIEKYEDLEELEDINGLKYREDLEHLEDLKDVKVPKYHKDLEYIEDLEVDSLT"
ORIGIN
atgtacatacgtacgtctcgattccatgacagtcgtgaagaccataacgaccttgaacatctcgagaacctcaaagattttgaaggccttgaagactatgaagactatgaaaaccatgaatatctcgaatactttgaagttcttgaattccttgaagaccgtggaaaccttgaagtccctaaataccataaaaaccttgaagaccttgaaaaagttgaagatcttaaacaccatgaagattttaaaaacgttaatgaacttaaaaaccttgaaaaaattgaaaaatatgaagatcttgaagagcttgaagacattaatggccttaaatatcgtgaagaccttgaacacctcgaagaccttaaagatgttaaagtccctaaataccataaagaccttgaatatatcgaagatcttgaagtagatagtctcacttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]