2024-04-26 15:43:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_037780765 2837 bp mRNA linear VRT 19-NOV-2020 DEFINITION PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494693), transcript variant X1, mRNA. ACCESSION XM_037780765 VERSION XM_037780765.1 DBLINK BioProject: PRJNA675852 KEYWORDS RefSeq. SOURCE Sebastes umbrosus (honeycomb rockfish) ORGANISM Sebastes umbrosus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Perciformes; Scorpaenoidei; Sebastidae; Sebastinae; Sebastes. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051277.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Sebastes umbrosus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2837 /organism="Sebastes umbrosus" /mol_type="mRNA" /isolate="fSebUmb1" /db_xref="taxon:72105" /chromosome="9" /sex="male" /tissue_type="muscle" /dev_stage="adult" /country="USA: California coast" /lat_lon="33.599833 N 118.265167 W" /collection_date="05-Oct-2017" /collected_by="University of Washington" gene 1..2837 /gene="LOC119494693" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:119494693" CDS 90..1526 /gene="LOC119494693" /codon_start=1 /product="C-type lectin domain family 4 member M-like isoform X1" /protein_id="XP_037636693.1" /db_xref="GeneID:119494693" /translation="
MQLMEVDDDELHVNKNLTMQGLLNSVDFQRKKQPSRCASVCLGLLCAVLLAGNIGQLVYYEIISRSASADPTQASYIQGGQEQSSYDALTAERKQLDARLTNLTKEKDLLQQSYSSVTTERDEFKASFNNLKNESDQLQVSYNTLKQESDQLQTNKDQLQTKYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQREKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLLKQKDELQTLSVTLRANRDQLQSNYSSLKINKDQLQRSYNTLSLSKIFLQTRYNSLEKDKERLQSSYNTLQREKEQLQTKYTSLAAARDQLQKKIDKVRAKPCQTGWSKFDISCYFVSNLEKNWTQSRQYCIAEGADLVVIDSRDEQAFVNGLLDDGKNAWTGMTDSIIEGIWMWVDGTPVTTTYWGEDQPNSYDGNQDCGETVQKSLGVGEWNDDGCFGDQNFICEK"
misc_feature <324..>1133 /gene="LOC119494693" /note="Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]; Region: Smc; COG1196" /db_xref="CDD:224117" misc_feature 1146..1523 /gene="LOC119494693" /note="C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR); Region: CLECT_DC-SIGN_like; cd03590" /db_xref="CDD:153060" misc_feature order(1314..1316,1407..1409,1413..1415,1431..1433, 1449..1454,1479..1490) /gene="LOC119494693" /note="carbohydrate binding site; other site" /db_xref="CDD:153060" misc_feature order(1335..1337,1347..1349,1416..1418,1431..1436) /gene="LOC119494693" /note="calcium binding site 1 [ion binding]; other site" /db_xref="CDD:153060" misc_feature order(1347..1349,1434..1436) /gene="LOC119494693" /note="calcium binding site 3 [ion binding]; other site" /db_xref="CDD:153060" ORIGIN
tgttgtaaatcagcagcatcttcatgtgaatgcagtcatactggtactgacttcttctctgatccaagggaaaacagacctttatcagaatgcagttaatggaagttgatgacgatgagctacatgtgaataagaacctcacaatgcaaggcctcctcaactcagttgattttcagaggaagaagcagccctctagatgtgcgtccgtgtgtcttggattactgtgtgctgtcctgttggctggtaacataggacagcttgtctactatgagataatcagccgctccgcgtcagcagacccaacgcaggccagctacattcaaggaggtcaagagcagagcagctatgatgctttaacagcagagagaaaacaattggatgccagactgactaacctgactaaagaaaaagacctgttgcagcaaagctacagctctgtgactactgaaagagatgagttcaaggccagtttcaacaatctgaaaaatgagagcgaccagttacaagtaagttacaacaccttaaaacaagagagcgatcagttacagactaataaagaccagctacagaccaagtacagtagcctgcaaagacaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagttacagacgaataaagaccagctacagaccaggtacagtagcctgcaaagagaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgctaaaacaaaaagatgagttacagactttgtctgttacgctgagagcaaacagagatcagttgcagagcaattactcctcactgaagattaacaaggaccagttgcaaagaagctataacacactgagtttaagtaagattttccttcagaccagatacaattcattggagaaagacaaagaacgattgcagtcgagctataatactctgcagagggaaaaagagcagttacagaccaaatacaccagtttggctgcagctagagatcagctacagaagaagatcgacaaagtgagagctaaaccctgtcagacaggctggagtaagttcgacatcagctgttactttgtttcaaatttggagaaaaactggacgcaaagccgacaatactgcatcgcagagggagcagatctagtcgtcatagacagcagggatgaacaggcatttgtcaacgggttactggatgacggcaaaaatgcctggactggtatgactgacagtattatagagggaatttggatgtgggtggacgggactccagtcaccactacgtactggggggaggaccagcccaacagctacgatgggaaccaggactgtggagaaactgtgcaaaagtcattgggagttggagaatggaacgatgacggctgttttggtgatcagaactttatctgtgagaaataatatcacaatgatttacacagttaatgatggtgtgttggactgcagttctaatgtacgtcataactaattgattatttgtattaatctgcagctgaaaatagtccccaacaaatagcgtgtttacttcagtttgctaaaatctacaatgttccgctgttttaggaaatgactgagccttttttgaaaatgatggtatacatttatggctgtttttaaagattttcatcttcagtgggaactccatagactttcagaaagtgctgagagatggacgaacacattggttttggtctttccatggggtttgtagacaataacaaaaatatataataatctcagctttattctttgatactgttaaaggctgttttcagttaatctggctgattagacctcttctcaggactgtgtgtgcatgtatagactaatgagtcacatcttcctgattctcctgttagctttgttgaacctgttaaggcgggataaattacacctttatcattcttattggtcgatgaagatttttgacctaataaatccccatcaaagctccggcccaccttcaacctgagcagaggtctaatcagacagaataactgaaatcacttgtgtgggtgttcagaggctttaaaggtcggttcacccaaattactatcgaacatatttctcatatttccacacctctagtggacatgtacgatatctatctctgagatttctgcctccagacagccaagtcttaatatattaaactttttaagctttaatgattttagacgagtacactttgatgcataacattgttaacatgttcataaatgtactatttagctgatgatttgtgtttgatgtaatggaatatgaatttcttggttgtacaaaaacgggttttactatgtgttaccgtgttctcttatgagtgtgctacatcagattcagcaaacactcctaacttcagataactgtgtaaatgcgtaaacatgatgaatgccacctgtgtggaaatgagcaatcgttcatgaaaattgtaaattaacataattaacaccccaatgataccaagtatgaatctgtttgtaggagttgttcttgaggccaattgtctagtactctactatgatattctgtggcctttggcatagctttagaaatgtgtgcaaattgccatctgtttgattaatgaaattgtatgcaaattaatgtttaacacaaataatgtatgttacaaagcacatgcatacaacatttgcatatggttttaataatttactgtatcactctgtaatgattaaaaaatactggcacaaatta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]