2024-04-26 15:29:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_035699182 1107 bp mRNA linear MAM 15-JUL-2022 DEFINITION PREDICTED: Canis lupus dingo claudin 19 (CLDN19), transcript variant X3, mRNA. ACCESSION XM_035699182 VERSION XM_035699182.2 DBLINK BioProject: PRJNA477859 KEYWORDS RefSeq. SOURCE Canis lupus dingo (dingo) ORGANISM Canis lupus dingo Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064257) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jul 15, 2022 this sequence version replaced XM_035699182.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: Canis lupus dingo Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1107 /organism="Canis lupus dingo" /mol_type="mRNA" /isolate="Sandy" /sub_species="dingo" /db_xref="taxon:286419" /chromosome="15" /sex="female" /tissue_type="muscle" gene 1..1107 /gene="CLDN19" /note="claudin 19; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:112642257" CDS 413..1015 /gene="CLDN19" /codon_start=1 /product="claudin-19 isoform X3" /protein_id="XP_035555075.1" /db_xref="GeneID:112642257" /translation="
MSVPLLLPGCGLERDKLACKPAPLQLCPCPGPRRPDPTSYHTSLLYDTHAGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRIAISGGVLFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGSALFVGWASAGLAMLGGSFLCCTCPEPERAASSPQPYRPGPSAAAREPVVKLSASAKGPLGV"
misc_feature <560..886 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" polyA_site 1107 /gene="CLDN19" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ggggggcaggccagcttgcccgcagcctgccacctgcgctgggctccaccctccggcccccccctcatgcattttgaacatccaaggccagatgggtggtcccacccgtggaggggggcgctcggggttctggcagccacgggtccagatcccagctctgccgcgagaaccttaaaggagtccaaccctttcctgttctaacgtccccaggcccccagccggaggggggagcactagggcttcacagggctgtggcagggttagaccgggtcgaggggtgcctggctcctcccgaagagccgcgtgcagacacgccgtgcagtgcacatgcacctccgggcctgccacctaggcaagcgggcctccgtttgggtgcacacacacgtgtgcctgtgcacacaggtgcttgggcatgtcggtccctctccttctcccggggtgtggacttgaacgtgacaagttggcttgtaagccggcaccactgcagctgtgtccctgcccagggccgcgcaggcctgaccccaccagctatcacaccagcctcctctatgacacccatgcaggtcacatccagtcagcgcgagccctgatggtggtggccgtgctcctgggctttgtggccatggtcctcagtgtggtcggcatgaagtgcactcgggttggagacagcaaccccaccgccaagggccgcatcgccatctctgggggtgtcctcttcctgctggcaggcctctgcactctgacagccgtttcgtggtatgccaccctggtgacacaggagttcttcaaccccagcacacctgtcaacgccaggtacgagttcggctcggccctgttcgtgggctgggcatcggccggcctggccatgctggggggctccttcctctgctgcacgtgccccgagcctgagcgcgccgccagcagcccgcagccttaccggccgggcccatcggccgctgcccgagaaccagttgttaaattgtccgcctccgccaagggccccctgggtgtgtaatgtccaggcccccaccctgactctgtcccccgccacatctagcctgcgtgtttggtattttttggaaagagaagcgaacatccagccccaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]