GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 15:29:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_035699182            1107 bp    mRNA    linear   MAM 15-JUL-2022
DEFINITION  PREDICTED: Canis lupus dingo claudin 19 (CLDN19), transcript
            variant X3, mRNA.
ACCESSION   XM_035699182
VERSION     XM_035699182.2
DBLINK      BioProject: PRJNA477859
KEYWORDS    RefSeq.
SOURCE      Canis lupus dingo (dingo)
  ORGANISM  Canis lupus dingo
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
            Canis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064257) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 15, 2022 this sequence version replaced XM_035699182.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Canis lupus dingo Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1107
                     /organism="Canis lupus dingo"
                     /mol_type="mRNA"
                     /isolate="Sandy"
                     /sub_species="dingo"
                     /db_xref="taxon:286419"
                     /chromosome="15"
                     /sex="female"
                     /tissue_type="muscle"
     gene            1..1107
                     /gene="CLDN19"
                     /note="claudin 19; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:112642257"
     CDS             413..1015
                     /gene="CLDN19"
                     /codon_start=1
                     /product="claudin-19 isoform X3"
                     /protein_id="XP_035555075.1"
                     /db_xref="GeneID:112642257"
                     /translation="
MSVPLLLPGCGLERDKLACKPAPLQLCPCPGPRRPDPTSYHTSLLYDTHAGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRIAISGGVLFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGSALFVGWASAGLAMLGGSFLCCTCPEPERAASSPQPYRPGPSAAAREPVVKLSASAKGPLGV"
     misc_feature    <560..886
                     /gene="CLDN19"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     polyA_site      1107
                     /gene="CLDN19"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
ggggggcaggccagcttgcccgcagcctgccacctgcgctgggctccaccctccggcccccccctcatgcattttgaacatccaaggccagatgggtggtcccacccgtggaggggggcgctcggggttctggcagccacgggtccagatcccagctctgccgcgagaaccttaaaggagtccaaccctttcctgttctaacgtccccaggcccccagccggaggggggagcactagggcttcacagggctgtggcagggttagaccgggtcgaggggtgcctggctcctcccgaagagccgcgtgcagacacgccgtgcagtgcacatgcacctccgggcctgccacctaggcaagcgggcctccgtttgggtgcacacacacgtgtgcctgtgcacacaggtgcttgggcatgtcggtccctctccttctcccggggtgtggacttgaacgtgacaagttggcttgtaagccggcaccactgcagctgtgtccctgcccagggccgcgcaggcctgaccccaccagctatcacaccagcctcctctatgacacccatgcaggtcacatccagtcagcgcgagccctgatggtggtggccgtgctcctgggctttgtggccatggtcctcagtgtggtcggcatgaagtgcactcgggttggagacagcaaccccaccgccaagggccgcatcgccatctctgggggtgtcctcttcctgctggcaggcctctgcactctgacagccgtttcgtggtatgccaccctggtgacacaggagttcttcaaccccagcacacctgtcaacgccaggtacgagttcggctcggccctgttcgtgggctgggcatcggccggcctggccatgctggggggctccttcctctgctgcacgtgccccgagcctgagcgcgccgccagcagcccgcagccttaccggccgggcccatcggccgctgcccgagaaccagttgttaaattgtccgcctccgccaagggccccctgggtgtgtaatgtccaggcccccaccctgactctgtcccccgccacatctagcctgcgtgtttggtattttttggaaagagaagcgaacatccagccccaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]