ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-10 19:42:11, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_029726743 493 bp mRNA linear VRT 10-JUL-2025
DEFINITION PREDICTED: Salmo trutta RNA binding protein fox-1 homolog 1
(LOC115170528), mRNA.
ACCESSION XM_029726743
VERSION XM_029726743.1
DBLINK BioProject: PRJNA550988
KEYWORDS RefSeq; includes ab initio.
SOURCE Salmo trutta (river trout)
ORGANISM Salmo trutta
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_042988.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Updated annotation
Annotation Name :: GCF_901001165.1-RS_2025_07
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.4
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 07/09/2025
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 7% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..493
/organism="Salmo trutta"
/mol_type="mRNA"
/db_xref="taxon:8032"
/chromosome="32"
gene 1..493
/gene="LOC115170528"
/note="RNA binding protein fox-1 homolog 1; Derived by
automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 94% coverage of the annotated genomic feature by
RNAseq alignments, including 10 samples with support for
all annotated introns"
/db_xref="GeneID:115170528"
CDS 179..493
/gene="LOC115170528"
/codon_start=1
/product="RNA binding protein fox-1 homolog 1"
/protein_id="XP_029582603.1"
/db_xref="GeneID:115170528"
/translation="
MEEKEEGKMVEQGNQEAPPPPDSMTQPYPSAQFAPPQNGLPAEFTASHPHPAPPDYTGQPPVSEHPLNMYPTSQNHSEQSGQDTSIQPVSATATVRHLYFITTS"
ORIGIN
cactcacacacacacacatacactgaacacacacacacgcacacactgaacacacccacacacggggaacccacgccccatccataattgatgctagctgtgggcaggcagatgctggaggcaggaggaagaagggaggaagaagggagggaaggagggaaagcagctggatgtgtttatggaggagaaagaggaaggcaagatggtggagcagggtaaccaggaagcccctccccctccagactccatgactcagccgtacccctccgcccaatttgccccccctcagaacggcttgcccgctgagttcaccgcctctcaccctcaccctgcgccccccgactacacaggacagccccccgtcagtgaacaccccctcaacatgtaccccacttcacagaaccacagtgaacagagtggacaggacaccagcatacagcccgtctcagccacagccacagtaagacatctctactttattacaacatcttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]