GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-04 14:04:21, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_026823937             459 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Diaphorina citri uncharacterized LOC113467646
            (LOC113467646), mRNA.
ACCESSION   XM_026823937
VERSION     XM_026823937.1
DBLINK      BioProject: PRJNA251515
KEYWORDS    RefSeq.
SOURCE      Diaphorina citri (Asian citrus psyllid)
  ORGANISM  Diaphorina citri
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Psylloidea; Psyllidae; Diaphorininae; Diaphorina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007377950.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Diaphorina citri Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..459
                     /organism="Diaphorina citri"
                     /mol_type="mRNA"
                     /db_xref="taxon:121845"
                     /chromosome="Unknown"
                     /collection_date="2010"
     gene            1..459
                     /gene="LOC113467646"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 1 sample
                     with support for all annotated introns"
                     /db_xref="GeneID:113467646"
     CDS             94..399
                     /gene="LOC113467646"
                     /codon_start=1
                     /product="uncharacterized protein LOC113467646"
                     /protein_id="XP_026679738.1"
                     /db_xref="GeneID:113467646"
                     /translation="
MSDEEEETVTDDVTAVTVKDGSKMCGYLEKKGKLGVTGRWRSWYCVLDGHLLLQYKSQSEYLSLSPCRGSINLALAKSIEKRPRLEIHIATRSQVILLVPQ"
     misc_feature    163..393
                     /gene="LOC113467646"
                     /note="Pleckstrin homology domain; Region: PH; smart00233"
                     /db_xref="CDD:214574"
ORIGIN      
tcaggttccacagtgaccttgaactttgaccaaaatcaaagcaccaatcacaaggccgtacaatatccaaagcaccaatcagaaggctggaaaatgtccgacgaggaagaagagacggttactgatgacgtcacagcagttacggttaaagatggcagcaaaatgtgtggctatctggagaagaagggaaaactgggtgtcaccggtcgctggcgcagttggtactgcgtgctagacggccacctgctcctccagtacaagagccagtcggaatatctctcgctgtcaccctgtagggggtctataaatctggccctggcgaagtcgatagagaagagaccgcgcctggagattcatatagctactcgatctcaagttatactgttggttccacagtgaccttgaactttgaccgaaatcaaagcgccaatcacaaggccgtataatatccaaagcacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]