GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 02:31:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_026382723             330 bp    mRNA    linear   ROD 11-SEP-2018
DEFINITION  PREDICTED: Urocitellus parryii cytochrome P450 2C42-like
            (LOC113178372), partial mRNA.
ACCESSION   XM_026382723
VERSION     XM_026382723.1
DBLINK      BioProject: PRJNA489874
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Urocitellus parryii (Arctic ground squirrel)
  ORGANISM  Urocitellus parryii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciuromorpha; Sciuridae; Xerinae; Marmotini; Urocitellus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020542464.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Urocitellus parryii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..330
                     /organism="Urocitellus parryii"
                     /mol_type="mRNA"
                     /isolate="AGS 11-09-20"
                     /isolation_source="Arctic tundra"
                     /db_xref="taxon:9999"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="skeletal muscle"
                     /dev_stage="adult"
                     /ecotype="Arctic tundra"
                     /country="USA: Alaska, Toolik Lake"
                     /lat_lon="68.63 N 149.6 W"
                     /collection_date="27-Jul-2011"
                     /collected_by="Institute of Arctic Biology"
     gene            <1..>330
                     /gene="LOC113178372"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 99% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:113178372"
     CDS             <1..>330
                     /gene="LOC113178372"
                     /codon_start=1
                     /product="cytochrome P450 2C42-like"
                     /protein_id="XP_026238508.1"
                     /db_xref="GeneID:113178372"
                     /translation="
EKNNQQSEFTTENLLTTVTDVFGAGTETTSTTMRYGLLLLLKHTDITAKVQEEIDQVIGRHRSPCMQDRSRMPYTEAVLHEIQRYIDLIPTNLPHAVTCDVKFRNYFIPK"
     misc_feature    <1..>330
                     /gene="LOC113178372"
                     /note="cytochrome P450 (CYP) superfamily; Region:
                     cytochrome_P450; cl41757"
                     /db_xref="CDD:425388"
     misc_feature    order(58..60,67..72,82..84,271..282)
                     /gene="LOC113178372"
                     /note="chemical substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:410651"
ORIGIN      
gaaaagaacaatcaacagtctgaatttaccactgaaaacttgttaaccactgtaactgatgtgtttggagcgggaacagagacaacaagcaccactatgagatatggacttttgctcctgctaaagcatacagatatcacagctaaagtccaagaagagattgaccaagtgattggcagacaccgcagcccttgcatgcaggacaggagccgcatgccctacacagaggctgtgttacacgagatccagagatacattgatctcatccccaccaatctgccccatgcagtgacctgtgatgttaaatttagaaactacttcatccccaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]