2024-04-26 02:31:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026382723 330 bp mRNA linear ROD 11-SEP-2018 DEFINITION PREDICTED: Urocitellus parryii cytochrome P450 2C42-like (LOC113178372), partial mRNA. ACCESSION XM_026382723 VERSION XM_026382723.1 DBLINK BioProject: PRJNA489874 KEYWORDS RefSeq; includes ab initio. SOURCE Urocitellus parryii (Arctic ground squirrel) ORGANISM Urocitellus parryii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciuromorpha; Sciuridae; Xerinae; Marmotini; Urocitellus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020542464.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Urocitellus parryii Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..330 /organism="Urocitellus parryii" /mol_type="mRNA" /isolate="AGS 11-09-20" /isolation_source="Arctic tundra" /db_xref="taxon:9999" /chromosome="Unknown" /sex="male" /tissue_type="skeletal muscle" /dev_stage="adult" /ecotype="Arctic tundra" /country="USA: Alaska, Toolik Lake" /lat_lon="68.63 N 149.6 W" /collection_date="27-Jul-2011" /collected_by="Institute of Arctic Biology" gene <1..>330 /gene="LOC113178372" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 99% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:113178372" CDS <1..>330 /gene="LOC113178372" /codon_start=1 /product="cytochrome P450 2C42-like" /protein_id="XP_026238508.1" /db_xref="GeneID:113178372" /translation="
EKNNQQSEFTTENLLTTVTDVFGAGTETTSTTMRYGLLLLLKHTDITAKVQEEIDQVIGRHRSPCMQDRSRMPYTEAVLHEIQRYIDLIPTNLPHAVTCDVKFRNYFIPK"
misc_feature <1..>330 /gene="LOC113178372" /note="cytochrome P450 (CYP) superfamily; Region: cytochrome_P450; cl41757" /db_xref="CDD:425388" misc_feature order(58..60,67..72,82..84,271..282) /gene="LOC113178372" /note="chemical substrate binding pocket [chemical binding]; other site" /db_xref="CDD:410651" ORIGIN
gaaaagaacaatcaacagtctgaatttaccactgaaaacttgttaaccactgtaactgatgtgtttggagcgggaacagagacaacaagcaccactatgagatatggacttttgctcctgctaaagcatacagatatcacagctaaagtccaagaagagattgaccaagtgattggcagacaccgcagcccttgcatgcaggacaggagccgcatgccctacacagaggctgtgttacacgagatccagagatacattgatctcatccccaccaatctgccccatgcagtgacctgtgatgttaaatttagaaactacttcatccccaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]