2025-07-04 08:31:48, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_023189701 1219 bp mRNA linear PRI 30-DEC-2019 DEFINITION PREDICTED: Piliocolobus tephrosceles claudin 17 (CLDN17), mRNA. ACCESSION XM_023189701 VERSION XM_023189701.3 DBLINK BioProject: PRJNA419387 KEYWORDS RefSeq. SOURCE Piliocolobus tephrosceles (Ugandan red Colobus) ORGANISM Piliocolobus tephrosceles Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Colobinae; Piliocolobus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_045452.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Dec 30, 2019 this sequence version replaced XM_023189701.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Piliocolobus tephrosceles Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1219 /organism="Piliocolobus tephrosceles" /mol_type="mRNA" /isolate="RC106" /isolation_source="whole blood" /db_xref="taxon:591936" /chromosome="19" /sex="male" /geo_loc_name="Uganda: Kibale National Park" /lat_lon="0.4862 N 30.3897 E" /collection_date="27-Jul-2014" gene 1..1219 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins" /db_xref="GeneID:111524515" CDS 183..857 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_023045469.2" /db_xref="GeneID:111524515" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGAALFLGWASTAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKQRNVTMPGNTSTSYV"
misc_feature 198..728 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
tacaacaggtacttctagttaggccaagttcagtcacagtcactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttcgctagactcaagagccttccacgttctacatcttgagcatcttctaccactccgaattggactagttttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaaacaggtccagtgcacgggctctaatgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccagtgagctggacagccaatataatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttcctcggctgggcaagcactgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcaaagaaacgtgacaatgcctggtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatatctagatttaaattgatatgaaagtttcagtttgttaccggtaggaaagaaaatgacttacttggacattctgacttcaggtgtattaaatgcctttactattgttggactcaattgctgttccaatgttcatattctaaatgcaagtatgcccataatcattatcaagtgtacaatgatggactactttttgactatcatattttatctgataagaatcaaaatttgaaatcaatactctataacaataaaacatatacctatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]