GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 15:24:22, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_021396624             711 bp    mRNA    linear   VRT 07-JUN-2017
DEFINITION  PREDICTED: Numida meleagris mitochondrial ribosomal protein L35
            (MRPL35), transcript variant X2, mRNA.
ACCESSION   XM_021396624
VERSION     XM_021396624.1
DBLINK      BioProject: PRJNA383663
KEYWORDS    RefSeq.
SOURCE      Numida meleagris (helmeted guineafowl)
  ORGANISM  Numida meleagris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Numididae; Numida.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_034412.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Numida meleagris Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Numida meleagris"
                     /mol_type="mRNA"
                     /isolate="19003"
                     /db_xref="taxon:8996"
                     /chromosome="4"
                     /sex="male"
                     /tissue_type="Blood"
                     /breed="g44 Domestic line"
     gene            1..711
                     /gene="MRPL35"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 34 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:110398708"
     CDS             138..626
                     /gene="MRPL35"
                     /codon_start=1
                     /product="39S ribosomal protein L35, mitochondrial isoform
                     X2"
                     /protein_id="XP_021252299.1"
                     /db_xref="GeneID:110398708"
                     /translation="
MLRPLARWAPLAAGRAASVRCCHGRARAAAVLAKPLSLRNVPGGAPPALLSRLTPLLPSILQQPVRPLTYCGLRKGKRKSVKAVVKRFLRLHNGLWVRRKSGYKKRLWKKSTAQKKRLREFVLCNRTQCKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLTV"
     misc_feature    363..542
                     /gene="MRPL35"
                     /note="Ribosomal protein L35; Region: Ribosomal_L35p;
                     pfam01632"
                     /db_xref="CDD:460273"
ORIGIN      
attttagaaagcgcccggacggggctgcgctcctcccagcgggggcgcggcgctctgcagccgtccgtcggcacggctcggcctgacctccgccggctgccgtaggctgagcgcggggacatggcggcggcggtgggatgctccggccgctggcgcgctgggccccgctggctgcggggcgagctgcgtccgtccggtgttgccacggccgagcgcgggctgcggctgtgctggcgaaaccgctgtccctcaggaacgtgcccggcggggccccccccgcgctgctcagcagactcacacctctacttccaagcatacttcagcagccggtgaggcccctcacgtattgtggcttacggaaggggaagaggaagagcgtgaaagccgtcgtgaagaggtttctccgactgcacaatggtctttgggttaggagaaagtctggttacaagaagagattgtggaagaagtctactgcccagaagaagcgcttgagagagtttgtgctgtgcaatagaacacaatgtaaactcctagataaaatgaccacttctttctggaaaagaagaaattggtatgttgacgatccctaccagaagtatcacgatcgcaccaatcttactgtgtaaaatctgtattttttttttaataaataaacttatgcatctcacctgctgagaatgatggcccggaataaaggaatactaaagacta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]