GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-06-08 02:43:36, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_018882878             681 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans bifunctional glutathione
            transferase/peroxidase (GTT1), partial mRNA.
ACCESSION   XM_018882878
VERSION     XM_018882878.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella.
REFERENCE   1  (bases 1 to 681)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 681)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 681)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031672).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="A"
     gene            <1..>681
                     /gene="GTT1"
                     /locus_tag="AWJ20_908"
                     /db_xref="GeneID:30037992"
     CDS             1..681
                     /gene="GTT1"
                     /locus_tag="AWJ20_908"
                     /inference="similar to AA sequence:KEGG_Orthology:K00799"
                     /note="ER associated glutathione S-transferase capable of
                     homodimerization; expression induced during the diauxic
                     shift and throughout stationary phase; functional overlap
                     with Gtt2p, Grx1p, and Grx2p; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     9792709]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16622836]; GO_function: GO:0004602 - glutathione
                     peroxidase activity [Evidence IDA] [PMID 16709151];
                     GO_function: GO:0004364 - glutathione transferase activity
                     [Evidence IEA]; GO_function: GO:0004364 - glutathione
                     transferase activity [Evidence IDA,ISS] [PMID 9792709];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0006749 - glutathione metabolic
                     process [Evidence IDA] [PMID 9792709]"
                     /codon_start=1
                     /product="bifunctional glutathione transferase/peroxidase"
                     /protein_id="XP_018735123.1"
                     /db_xref="GeneID:30037992"
                     /translation="
MPAQITLYDLERSRSQRIGWLLEELKVDYNVETFKRNERQRADPALFKIHPLGKAPVISVDGKIIAESAVIIDYLIKNFGQGSELEAKNEEEAFDINYYLHHSEATLQPCLLLLFVTDVTNKQAPYLLKSVAKKVTEAQDDGYALPELKLNLKYLDDKLKTNGTGFFVGDHLSGADIIYSFPLLDAKHRKFATAEDYPHIFKWIDLITARPAYKAALEKTGKPAKI"
     misc_feature    13..657
                     /gene="GTT1"
                     /locus_tag="AWJ20_908"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: GstA;
                     COG0625"
                     /db_xref="CDD:440390"
ORIGIN      
atgcctgcacaaattactctttatgacctcgagcgatcgcgttcgcagagaattggctggcttttggaagagctcaaggtagactataacgtcgagacgtttaagcgtaacgagcgtcagagagccgatcctgcactattcaagatccatcctctcggaaaagcaccagtgatcagtgttgatggtaagatcattgctgaaagtgctgtgatcattgactatctgatcaagaattttggtcaaggaagtgagctcgaggccaagaacgaagaagaggcctttgatatcaactactatctccaccactccgaggccactcttcagccatgtttgttattgctgttcgtcaccgacgtgacaaacaaacaagctccctacctcctcaaatcagttgccaaaaaggtcaccgaggcccaagacgatggctatgctctgcccgaactcaagctcaacctgaagtacctcgacgacaagctcaagaccaacggcaccggtttcttcgtcggcgaccatctctccggtgccgacatcatctactcgttcccactactcgacgccaaacaccgcaagttcgcgaccgccgaggactacccccatatcttcaagtggatcgatctcattaccgcccgtcccgcctacaaagccgctctcgagaagaccggcaagcctgctaaaatctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]