GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 20:58:59, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_018881381             600 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Oye2p (OYE2), partial mRNA.
ACCESSION   XM_018881381
VERSION     XM_018881381.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella.
REFERENCE   1  (bases 1 to 600)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 600)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 600)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031671).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..600
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="C"
     gene            <1..>600
                     /gene="OYE2"
                     /locus_tag="AWJ20_4314"
                     /db_xref="GeneID:30036433"
     CDS             1..600
                     /gene="OYE2"
                     /locus_tag="AWJ20_4314"
                     /inference="similar to AA sequence:KEGG_Orthology:K00354"
                     /note="Conserved NADPH oxidoreductase containing flavin
                     mononucleotide (FMN); responsible for geraniol reduction
                     into citronellol during fermentation; homologous to Oye3p
                     with different ligand binding and catalytic properties;
                     may be involved in sterol metabolism, oxidative stress
                     response, and programmed cell death; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 17897954]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0010181 -
                     FMN binding [Evidence IEA]; GO_function: GO:0003959 -
                     NADPH dehydrogenase activity [Evidence IEA]; GO_function:
                     GO:0003959 - NADPH dehydrogenase activity [Evidence
                     IDA,ISS] [PMID 8454584]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0016491
                     - oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0018548 - pentaerythritol trinitrate reductase activity
                     [Evidence IEA]; GO_function: GO:0052690 -
                     trichloro-p-hydroquinone reductive dehalogenase activity
                     [Evidence IEA]; GO_process: GO:0006915 - apoptotic process
                     [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Oye2p"
                     /protein_id="XP_018733976.1"
                     /db_xref="GeneID:30036433"
                     /translation="
MSRFETYPITYRARRIESRFLVMAGSVSPLFQPIKVGRATLQHRVAMAPLTRRRSPNHVPTDLVAEYYEQRASRPGTLIITEAAFIAKKAGGLSGAPGIWSQEQITAWKKVFDRIRAKQSFAFVQLWALGNRAYIPDLEEDGIKNYYVSASDVKARDDTPNPRPLTKSEIKEYIELYAQAAKNAIAAGASGVELHSANG"
     misc_feature    85..>597
                     /gene="OYE2"
                     /locus_tag="AWJ20_4314"
                     /note="A large family of domains similar to triose
                     phosphate isomerase (TIM) which, in general, share an
                     eight beta/alpha closed barrel structure; Region: TIM-like
                     beta/alpha barrel domains; cl21457"
                     /db_xref="CDD:473867"
ORIGIN      
atgtcgcgattcgagacttatccgattacatatcgtgcaagacgcattgagagcaggtttttggtcatggctgggtcggtgtctcctctgtttcaacctataaaagtcggtagagccactctgcaacacagagtggccatggctccattgacaagacggcggtcgccgaaccacgttcctactgacctcgtagcagagtattacgaacagcgggcgtcgagaccaggtactcttattattacagaggcagcatttattgcaaagaaagcaggtggtctcagtggtgctcctgggatatggtctcaagaacagattactgcatggaagaaagtgtttgatagaattcgtgccaaacagtcgtttgcgtttgtccagctgtgggctcttggtaacagagcatacatccccgatctcgaggaagatgggattaaaaactattacgtttcagcgtcagacgtcaaagcaagagacgacacccctaatccacgaccactcaccaaatccgaaatcaaggagtatatcgagctgtatgctcaggcggccaagaacgccattgcagcaggagcttcaggtgtcgaactccattcagccaacgggtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]