2025-04-04 14:09:32, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_018879960 963 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans 3-dehydrosphinganine reductase (TSC10), partial mRNA. ACCESSION XM_018879960 VERSION XM_018879960.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 963) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 963) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 963) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031674). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..963 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="B" gene <1..>963 /gene="TSC10" /locus_tag="AWJ20_2977" /db_xref="GeneID:30034947" CDS 1..963 /gene="TSC10" /locus_tag="AWJ20_2977" /inference="similar to AA sequence:KEGG_Orthology:K04708" /note="3-ketosphinganine reductase; catalyzes the second step in phytosphingosine synthesis; essential for growth in the absence of exogenous dihydrosphingosine or phytosphingosine; localized to lipid droplets; member of short chain dehydrogenase/reductase protein family; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0005811 - lipid particle [Evidence IDA] [PMID 24868093]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_component: GO:0005741 - mitochondrial outer membrane [Evidence IDA] [PMID 16407407]; GO_function: GO:0047560 - 3-dehydrosphinganine reductase activity [Evidence IEA]; GO_function: GO:0047560 - 3-dehydrosphinganine reductase activity [Evidence IDA] [PMID 9804843]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_process: GO:0006666 - 3-keto-sphinganine metabolic process [Evidence IDA] [PMID 9804843]; GO_process: GO:0006629 - lipid metabolic process [Evidence IEA]; GO_process: GO:0008152 - metabolic process [Evidence IEA]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA]; GO_process: GO:0030148 - sphingolipid biosynthetic process [Evidence IDA,IMP,ISS] [PMID 9804843]; GO_process: GO:0006665 - sphingolipid metabolic process [Evidence IEA,IEA]" /codon_start=1 /product="3-dehydrosphinganine reductase" /protein_id="XP_018737827.1" /db_xref="GeneID:30034947" /translation="
MSYFETKGKLAVISGGSQGLGAALAKQLILKGSNVVIVSRTESKLQKTVTSLELSRLNDDQLIKYIVADVSDPTECSRVFQELDDVPDIVICCAGGAVPGLLVDMEADTLKKHMAICYDTALFFSHAAMKVMIPKQKEIEAHHGRPSKRHLIYCSSVLALFPFIGYGSYGPAKAAIRALADIARQECIPYNISVANILPGNMATEGFVEEEKTKPEITRKIEGPSDARDPDIVAKEVIRDLERGQEMIYTDLIGWILSGLMMGASPRNWGIFQSIIAAVLVFFAPVWMFFVRKDIKDYFQKKTEEEHISKTKTEQTSNSK"
misc_feature 22..762 /gene="TSC10" /locus_tag="AWJ20_2977" /note="3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR; Region: KDSR-like_SDR_c; cd08939" /db_xref="CDD:187643" misc_feature order(43..45,49..60,115..123,202..210,277..285,346..348, 460..468,505..507,517..519,595..606,610..615) /gene="TSC10" /locus_tag="AWJ20_2977" /note="putative NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187643" misc_feature order(217..219,301..309,313..315,328..330,340..342, 364..366,376..378,385..390,484..495,499..501,508..513, 520..525,529..537,541..549,553..558,577..579,694..696, 706..708,718..720,724..729,745..762) /gene="TSC10" /locus_tag="AWJ20_2977" /note="homotetramer interface [polypeptide binding]; other site" /db_xref="CDD:187643" misc_feature order(349..351,466..468,505..507,517..519) /gene="TSC10" /locus_tag="AWJ20_2977" /note="active site" /db_xref="CDD:187643" misc_feature order(571..573,577..579,694..696,703..708,718..720, 724..726,745..762) /gene="TSC10" /locus_tag="AWJ20_2977" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:187643" ORIGIN
atgtcttattttgaaaccaaagggaagctggcagtaatatcaggtggttcacagggactgggggctgcactggcaaaacagcttatactcaaggggtctaatgttgttatcgtttcgagaactgaatcaaagctacagaaaactgtcacttcactagaattatccagattgaacgatgatcaattgatcaaatatattgtagcagatgtctcagatcctacagaatgttcccgtgtattccaggagctcgacgatgttccagatattgttatttgttgtgctggcggtgcggtcccaggattgctggtagacatggaagctgataccctgaagaaacacatggcaatttgttatgataccgcactgttcttttctcatgcagccatgaaggtcatgattcctaaacaaaaggaaatagaggcccatcacggacgtccctcaaaacgacatttaatctactgctcatctgtcttggcattgttcccttttattggatatggatcctatgggccagctaaagctgctataagagctctggctgatatagctcgtcaggaatgtattccttataacatatcggttgcgaatattttacctggaaatatggcaaccgagggttttgttgaggaggagaagactaagccagaaattacacgtaaaatcgagggtccttcggatgcacgggatcctgatattgtagctaaagaagtcattcgtgatctggaacgtggtcaagaaatgatatatacggatttaattggctggattctcagtggtctgatgatgggtgctagtcccagaaattggggcattttccaatctatcattgctgcagtgctagtgttttttgcacctgtgtggatgttcttcgtgcgaaaagatattaaggactattttcagaagaagacggaagaggaacatattagtaaaactaaaactgagcagacttcgaattctaaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]