2025-04-04 14:07:41, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_018879638 480 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans C-8 sterol isomerase ERG2 (ERG2), partial mRNA. ACCESSION XM_018879638 VERSION XM_018879638.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 480) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 480) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 480) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031674). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..480 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="B" gene <1..>480 /gene="ERG2" /locus_tag="AWJ20_2679" /db_xref="GeneID:30034616" CDS 1..480 /gene="ERG2" /locus_tag="AWJ20_2679" /inference="similar to AA sequence:KEGG_Orthology:K09829" /note="C-8 sterol isomerase; catalyzes the isomerization of the delta-8 double bond to the delta-7 position at an intermediate step in ergosterol biosynthesis; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IC] [PMID 18459942]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_function: GO:0000247 - C-8 sterol isomerase activity [Evidence IMP] [PMID 18459942]; GO_function: GO:0016853 - isomerase activity [Evidence IEA]; GO_process: GO:0006696 - ergosterol biosynthetic process [Evidence IMP] [PMID 18459942]; GO_process: GO:0006629 - lipid metabolic process [Evidence IEA]; GO_process: GO:0006694 - steroid biosynthetic process [Evidence IEA]; GO_process: GO:0008202 - steroid metabolic process [Evidence IEA]; GO_process: GO:0016126 - sterol biosynthetic process [Evidence IEA,IEA]" /codon_start=1 /product="C-8 sterol isomerase ERG2" /protein_id="XP_018737536.1" /db_xref="GeneID:30034616" /translation="
MYHELKAEYGDYINDYDESEWVFNNAGNAMGTMFVLHASISEYLIFFGTAIGTEGHTGTHFADDYFLILAGEQTAAPAQARQPEVYLPGDSHHLPCGYNKQYRMPADSWALELAQGWIPTMLPFGFMEAFTSTMDFYSLAKTVRISAVNIVGNLLRGKI"
misc_feature <10..462 /gene="ERG2" /locus_tag="AWJ20_2679" /note="ERG2 and Sigma1 receptor like protein; Region: ERG2_Sigma1R; pfam04622" /db_xref="CDD:461372" ORIGIN
atgtaccacgagttgaaggccgagtatggtgattatatcaatgattacgacgagtctgagtgggttttcaacaacgctggtaatgccatgggcaccatgtttgtgttacatgcttccatttctgaatacctgattttcttcggaactgctattggtaccgaaggtcatacaggaactcactttgccgacgactacttcctaattctcgctggcgagcaaactgctgctcctgctcaagcccgtcaacccgaagtataccttcccggtgactcgcatcatttgccctgtggatacaacaaacaataccgaatgcctgccgactcctgggcactcgaactggcccaaggctggatccccaccatgctccccttcggattcatggaggccttcacctcgactatggacttctactccctggccaagacagtccgtatcagtgccgtcaacattgtcggcaacctcctcaggggtaagatctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]