2025-07-15 21:01:04, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018879618 1110 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Oye3p (OYE3), partial mRNA. ACCESSION XM_018879618 VERSION XM_018879618.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Dipodascomycetes; Dipodascales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 1110) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 1110) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1110) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031674). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1110 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="B" gene <1..>1110 /gene="OYE3" /locus_tag="AWJ20_2660" /db_xref="GeneID:30034596" CDS 1..1110 /gene="OYE3" /locus_tag="AWJ20_2660" /inference="similar to AA sequence:KEGG_Orthology:K00354" /note="Conserved NADPH oxidoreductase containing flavin mononucleotide (FMN); homologous to Oye2p with different ligand binding and catalytic properties; has potential roles in oxidative stress response and programmed cell death; GO_component: GO:0005575 - cellular_component [Evidence ND]; GO_function: GO:0010181 - FMN binding [Evidence IEA]; GO_function: GO:0003959 - NADPH dehydrogenase activity [Evidence IEA]; GO_function: GO:0003959 - NADPH dehydrogenase activity [Evidence IDA,ISS] [PMID 7836424]; GO_function: GO:0003824 - catalytic activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye3p" /protein_id="XP_018737517.1" /db_xref="GeneID:30034596" /translation="
MTVTSTTPSLFTPLKVGDLQLQHRVAMAPLTRFRTPNHIPPEVFGDYYEQRASRAGTLIVTEATLIAPQAGGYENVPGIWSQEQIKAWKSVMNKINGKKSYAFMQLWALGRVAHQDILDKEGVASDVVSASDVPLGETSDIPRPLTELEIKEYIRLYAQAAKNAIEAGASGVELHGANGYLPDQFLHESTNRRTDEYGGSIENRARFALEVIDALIEAVGAKRVAVRLSPFGEFNNMHPGVSPIPQWSYLISELERRAQQGNRLAYIHLVEPRVNGNVDIEYTGSNEFARNIWQGILVRAGGLIRDAEKFAESDPNTVVALGRYFISNPDLVDRLQKKIPLTPYNRETFYATDPHDTRGYIEFKFASQQ"
misc_feature 28..1038 /gene="OYE3" /locus_tag="AWJ20_2660" /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a...; Region: OYE_like_FMN; cd02933" /db_xref="CDD:239243" misc_feature order(85..87,91..93,187..189,313..315,679..681,901..903, 958..960,964..972) /gene="OYE3" /locus_tag="AWJ20_2660" /note="FMN binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature order(85..87,91..93,187..189,313..315,319..321,340..342, 523..525,532..534,538..540,679..681,700..702,901..903, 958..960,964..969) /gene="OYE3" /locus_tag="AWJ20_2660" /note="active site" /db_xref="CDD:239243" misc_feature order(91..93,319..321,523..525,532..534,538..540,967..969) /gene="OYE3" /locus_tag="AWJ20_2660" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature 538..540 /gene="OYE3" /locus_tag="AWJ20_2660" /note="catalytic residue [active]" /db_xref="CDD:239243" ORIGIN
atgaccgttacatctactactccatctttattcacccctctcaaggttggtgatttgcaacttcaacatcgtgttgctatggcaccattgaccagatttagaactccaaatcacattcctcctgaggtttttggtgattattatgaacagagagcctctagagctggaactttaattgttaccgaagctactcttattgctcctcaagctggaggatatgaaaatgtccccggaatctggtctcaagaacagattaaagcttggaagagtgtaatgaacaagattaacggaaagaaatcttatgctttcatgcagctgtgggctcttggaagagttgctcaccaagatattcttgacaaagaaggtgtcgctagtgatgtagtttctgcttcagatgttcctcttggtgagactagtgatattcctagacctcttacagagctagaaatcaaagagtatattagactgtatgctcaagccgctaagaatgccattgaagcaggagcttctggtgtcgaattacatggagccaacggctatttaccagaccagtttcttcatgaatccactaaccgtcgtaccgatgagtatggcggatcgattgagaacagagccagatttgctctagaggttatcgatgctttaattgaagctgttggtgctaagagagtcgcagtaagattatctcctttcggagagttcaataatatgcaccctggagtttcaccaattccacagtggtcatatttgattagcgagcttgagagaagagctcaacagggaaaccgattggcttatattcatcttgttgagcctcgtgttaacggtaacgtcgatattgaatatacgggtagtaacgagtttgcccgaaatatttggcagggtattcttgtgcgagccggtggcttgatccgggacgctgagaagtttgccgaaagtgacccaaacactgttgtagctcttggtcgatatttcatctcgaacccagatcttgtggatagattacagaagaagattcctctgacaccttataatagagagaccttttatgctactgatcctcatgacactagaggatatattgagttcaagtttgcatcccagcagtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]