ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-06 02:21:34, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_018168289 384 bp mRNA linear INV 29-APR-2022
DEFINITION PREDICTED: Hyalella azteca cornifin-B-like (LOC108679632), mRNA.
ACCESSION XM_018168289
VERSION XM_018168289.1
DBLINK BioProject: PRJNA342675
KEYWORDS RefSeq; includes ab initio.
SOURCE Hyalella azteca
ORGANISM Hyalella azteca
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
Multicrustacea; Malacostraca; Eumalacostraca; Peracarida;
Amphipoda; Senticaudata; Talitrida; Talitroidea; Hyalellidae;
Hyalella.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_025933300) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Hyalella azteca Annotation Release
101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 9.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..384
/organism="Hyalella azteca"
/mol_type="mRNA"
/isolate="HAZT.00-mixed"
/db_xref="taxon:294128"
/chromosome="Unknown"
/tissue_type="whole organism"
gene 1..384
/gene="LOC108679632"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:108679632"
CDS 1..384
/gene="LOC108679632"
/codon_start=1
/product="cornifin-B-like"
/protein_id="XP_018023778.1"
/db_xref="GeneID:108679632"
/translation="
MAAFRVNAPGYPPAIETDYPPAIETDYPPATEPAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETDYSPATETDYPTATETDYPPATGTGQISIAVYTLQRTC"
misc_feature 49..>309
/gene="LOC108679632"
/note="multifunctional oxoglutarate
decarboxylase/oxoglutarate dehydrogenase thiamine
pyrophosphate-binding subunit/dihydrolipoyllysine-residue
succinyltransferase subunit; Region: kgd; cl39092"
/db_xref="CDD:476867"
ORIGIN
atggcagcattccgcgtcaatgctcccggttatcctcctgccattgaaactgattatcctcctgccattgaaactgattatcctccggccactgagcctgctcatcctcctgccactgaaactgctcatcctcctgccactgaaactgctcatcctcctgccactgaaactgctcatcctcctgccactgagactgctcaccctcctgctactgagactgctcatcctcctgccactgagactgctcatcctcctgccactgaaactgattattctcctgccaccgaaactgattatcctactgccactgaaactgattatcctcctgccactggaactggtcagatttctattgctgtatacacgctacaacgaacttgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]