ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-08 15:24:27, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_014093812 645 bp mRNA linear PLN 26-JUN-2024
DEFINITION Trichoderma atroviride uncharacterized protein (TrAtP1_002718),
partial mRNA.
ACCESSION XM_014093812
VERSION XM_014093812.2
DBLINK BioProject: PRJNA1128265
BioSample: SAMN17838941
KEYWORDS RefSeq.
SOURCE Trichoderma atroviride
ORGANISM Trichoderma atroviride
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae;
Trichoderma.
REFERENCE 1 (bases 1 to 645)
AUTHORS Li,W.C., Lin,T.C., Chen,C.L., Liu,H.C., Lin,H.N., Chao,J.L.,
Hsieh,C.H., Ni,H.F., Chen,R.S. and Wang,T.F.
TITLE Complete Genome Sequences and Genome-Wide Characterization of
Trichoderma Biocontrol Agents Provide New Insights into their
Evolution and Variation in Genome Organization, Sexual Development,
and Fungal-Plant Interactions
JOURNAL Microbiol Spectr 9 (3), e0066321 (2021)
PUBMED 34908505
REFERENCE 2 (bases 1 to 645)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (26-JUN-2024) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 645)
AUTHORS Li,W.-C., Lin,T.-C., Chen,C.-L., Liu,H.-C., Lin,H.-N., Hsieh,C.-H.,
Ni,H.-F., Chen,R.-S. and Wang,T.-F.
TITLE Direct Submission
JOURNAL Submitted (21-JAN-2022) Institute of Molecular Biology, Academia
Sinica, IMB, #128, Sec2, Academia Rd, Taipei 11529, Taiwan
REMARK Annotation added by submitter
REFERENCE 4 (bases 1 to 645)
AUTHORS Li,W.-C., Chen,C.-L., Lin,H.-N. and Wang,T.-F.
TITLE Direct Submission
JOURNAL Submitted (13-OCT-2021) Institute of Molecular Biology, Academia
Sinica, IMB, #128, Sec2, Academia Rd, Taipei 11529, Taiwan
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NC_089401).
On Jun 26, 2024 this sequence version replaced XM_014093812.1.
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..645
/organism="Trichoderma atroviride"
/mol_type="mRNA"
/strain="P1"
/db_xref="taxon:63577"
/chromosome="2"
gene <1..>645
/locus_tag="TrAtP1_002718"
/old_locus_tag="TRIATDRAFT_269423"
/db_xref="GeneID:25779239"
CDS 1..645
/locus_tag="TrAtP1_002718"
/old_locus_tag="TRIATDRAFT_269423"
/note="antiSMASH:Cluster_2.2"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_013949287.2"
/db_xref="GeneID:25779239"
/translation="
MQPAPEISAESWKKEEMGEPNPVADLVLETLQHAPAMRYKGRKRVQDTLTLIPPARRTTELVGLLCAALRGEMIYWQRLQKIEQSISLESLRSMYIMNVILIVSVLTGLEVRQEEIVPPVPLACPVIEEDYLALDDILVQLQKLKTVDADDQANQIEVQRFRQVLGRLMARVRPGQLFAAMAGHLAQLVRDSAPDDNFDFANPRQVLTDCALYL"
ORIGIN
atgcagccggcaccagagatatcggccgagtcatggaaaaaagaggagatgggcgaaccaaaccctgtcgcagacttggtcttggagactctgcaacacgcgccagcaatgcgttacaagggtcggaaaagagtgcaagataccctcaccctcatcccgcccgcaaggagaacaacggagcttgtgggtcttctatgcgctgcgcttcggggagagatgatttattggcaacggcttcaaaagattgagcagtccatatcgttggagtctctgagatcaatgtacataatgaatgtcatactcatcgtctcggtcctgacaggactagaagtcaggcaagaagagattgtgccacccgtcccattggcgtgtcctgtgatagaggaggactacttggctttggatgacatactcgtccagctgcaaaagctgaaaacagttgatgccgacgatcaggcaaaccaaattgaagtgcaaagattcaggcaagttttgggtcgcctgatggcccgggtacgcccggggcaattgtttgctgctatggctgggcacctcgcccagcttgtgagagattcagctcccgacgacaacttcgatttcgctaatcctcgtcaagtcctaaccgactgtgccttgtacctttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]