ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-08 15:24:23, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_012975290 1153 bp mRNA linear PLN 24-JUN-2015
DEFINITION PREDICTED: Erythranthe guttatus uncharacterized LOC105951830
(LOC105951830), mRNA.
ACCESSION XM_012975290
VERSION XM_012975290.1
DBLINK BioProject: PRJNA285087
KEYWORDS RefSeq; includes ab initio.
SOURCE Erythranthe guttata (spotted monkey flower)
ORGANISM Erythranthe guttata
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012192934.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Erythranthe guttata Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.3
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 55% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1153
/organism="Erythranthe guttata"
/mol_type="mRNA"
/cultivar="IM62"
/db_xref="taxon:4155"
/chromosome="Unknown"
gene 1..1153
/gene="LOC105951830"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 57% coverage of the annotated
genomic feature by RNAseq alignments"
/db_xref="GeneID:105951830"
CDS 263..1153
/gene="LOC105951830"
/codon_start=1
/product="uncharacterized protein LOC105951830"
/protein_id="XP_012830744.1"
/db_xref="GeneID:105951830"
/translation="
MRDMDADRVRNYLEDQFLGFTSVPLSDIVSDESGNSPREFDLSSSEIMHSHAGFVELSFNYSGIISHESHSVSVADVAHEQNVSCDLDRIEFPDQETVNENERTVSEHLRFPCDELDPQVQGGSCPLENDDNDLSLKGGGSCPLRNGDNNLSSKGGYFPLENDDNSLRSEGGSCPLSCIEVSSLETGDAEKRDDHKGGGGDGGEGVSGILPLVVSDETKETVVQEEIVDMYMKGMQQFTDALAKMKLPMDTGDGSKVETDDAKMENNQAGPNGKIQGSKSPDLSSPRVFYGSGAFF"
ORIGIN
gttgcagcagtgtcgcaatggttgatgatggtagtaagaataactcggacgagttcattggatttgtcgaggtttgcatacatcaggcaagagagatacacaacatatgtatatatcaaaaccaggatgtctacgccaaattctgctccaccgataatcccgagtcgaaaatctcgaccaaggttatcaaccaaggtggcagaaatcccgttttcaacaaaaccttgaatctaagtttccgaaaactcgattcatccctaagatgcgagatatggatgctgatcgagtccgaaactatctcgaagatcaattccttggatttacgtcagtgcccctttctgatatcgtatcggacgagagtgggaattcgccacgagagttcgacttgtcctcgagcgaaattatgcattctcatgcgggttttgtcgaattgtcttttaactactctggaataatatctcacgagtctcattctgtatcggtggctgatgtggctcatgagcaaaatgtttcgtgtgatctcgataggatcgaattccccgatcaagaaactgtgaatgaaaacgaaagaacagtttcggagcacttgagattcccgtgtgacgagcttgacccccaggttcaggggggttcttgccccctagaaaatgacgataatgacctcagtttgaaaggggggggttcttgccccctcagaaatggcgataataacctcagttcaaaagggggttatttcccccttgagaatgacgataatagcctccgttcggaagggggttcttgccccctttcatgtattgaggttagttcactagaaacgggagatgcggaaaaacgagatgatcataagggaggtggtggagacgggggagagggtgtttcaggtattttgcctcttgtcgttagcgatgaaacaaaagagacggtggtgcaagaagagattgtggatatgtacatgaaaggtatgcagcaatttacggatgctttggcgaaaatgaagctaccgatggatactggagatggatcgaaagttgaaacggatgatgccaaaatggaaaataatcaggcgggcccgaatgggaaaatacagggatcgaaaagcccggatcttagtagcccgagggtgttttacggcagtggagctttcttttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]