ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-11 01:18:01, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_009287747 1281 bp mRNA linear VRT 05-DEC-2016
DEFINITION PREDICTED: Aptenodytes forsteri homeobox B8 (HOXB8), transcript
variant X1, mRNA.
ACCESSION XM_009287747
VERSION XM_009287747.1
DBLINK BioProject: PRJNA261081
KEYWORDS RefSeq.
SOURCE Aptenodytes forsteri (emperor penguin)
ORGANISM Aptenodytes forsteri
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Neoaves; Aequornithes;
Sphenisciformes; Spheniscidae; Aptenodytes.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_008796180.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Aptenodytes forsteri Annotation
Release 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1281
/organism="Aptenodytes forsteri"
/mol_type="mRNA"
/isolate="BGI_AS27"
/db_xref="taxon:9233"
/chromosome="Unknown"
/sex="male"
/geo_loc_name="Antarctica"
gene 1..1281
/gene="HOXB8"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 12 Proteins, and 65% coverage of
the annotated genomic feature by RNAseq alignments"
/db_xref="GeneID:103905941"
CDS 1..729
/gene="HOXB8"
/codon_start=1
/product="homeobox protein Hox-B8 isoform X1"
/protein_id="XP_009286022.1"
/db_xref="GeneID:103905941"
/translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGGETYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
misc_feature 451..606
/gene="HOXB8"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
ORIGIN
atgagctcttattttgtcaactcactcttctccaaatacaaaaccggggactccttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttttaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccagcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagcagccgctggacggaggagggggggggaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggaagagcccctgagccccacgttaatggcagttaatgtaagggaggggtgggaaaaaaaccaacaatgcatagaaaagagaaaggaaaaaaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggaggtctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaattctctctctctctctgtctttctctctgtctctctcttctgtcctggggggtgggttggttaacatagctttcaatgctataggagttacgtgaaattacatttgtgcactttttttttttaattttccacctttttggttgtggtttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgcaatagttatctctccctttctctctctttctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]