2024-03-29 22:54:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_008489050 231 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. ACCESSION XM_008489050 VERSION XM_008489050.1 DBLINK BioProject: PRJNA251515 KEYWORDS RefSeq; includes ab initio. SOURCE Diaphorina citri (Asian citrus psyllid) ORGANISM Diaphorina citri Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Psylloidea; Psyllidae; Diaphorininae; Diaphorina. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007459459.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Diaphorina citri Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 5% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..231 /organism="Diaphorina citri" /mol_type="mRNA" /db_xref="taxon:121845" /chromosome="Unknown" /collection_date="2010" gene 1..>231 /gene="LOC103524044" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 94% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="
MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC"
misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(21..23,66..68,108..110,120..122,174..176,195..197, 201..203) /gene="LOC103524044" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN
gcggcacgatgaagcgaaagtatcgcgtgtgtaacgtcacacgccgcccggctcagatgcaatcattccccttacaattagaaaacggacaaacggtggaatgtactgtagccaaatacttcctggacaaatacaagatgaagttacgcttcccacatctgccctgtttacaagtgggacaagagcacaagcacacctacttgcctcttgaagtaagtatacaacggtgcg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]