ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-10 23:42:15, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_007374654 300 bp mRNA linear PLN 29-DEC-2023
DEFINITION Spathaspora passalidarum NRRL Y-27907 uncharacterized protein
(SPAPADRAFT_55114), partial mRNA.
ACCESSION XM_007374654
VERSION XM_007374654.1
DBLINK BioProject: PRJNA225527
BioSample: SAMN00714472
KEYWORDS RefSeq.
SOURCE Spathaspora passalidarum NRRL Y-27907
ORGANISM Spathaspora passalidarum NRRL Y-27907
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Pichiomycetes; Debaryomycetaceae; Spathaspora.
REFERENCE 1 (bases 1 to 300)
AUTHORS Wohlbach,D.J., Kuo,A., Sato,T.K., Potts,K.M., Salamov,A.A.,
Labutti,K.M., Sun,H., Clum,A., Pangilinan,J.L., Lindquist,E.A.,
Lucas,S., Lapidus,A., Jin,M., Gunawan,C., Balan,V., Dale,B.E.,
Jeffries,T.W., Zinkel,R., Barry,K.W., Grigoriev,I.V. and Gasch,A.P.
TITLE Comparative genomics of xylose-fermenting fungi for enhanced
biofuel production
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (32), 13212-13217 (2011)
PUBMED 21788494
REFERENCE 2 (bases 1 to 300)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 300)
AUTHORS Kuo,A., LaButti,K.M., Sun,H., Clum,A., Pangilinan,J., Lindquist,E.,
Barry,K., Lucas,S., Lapidus,A., Wohlbach,D.J., Potts,K.M.,
Jeffries,T.W., Zinkel,R., Gasch,A.P. and Grigoriev,I.V.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE Direct Submission
JOURNAL Submitted (10-MAY-2011) US DOE Joint Genome Institute, 2800
Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_006767427).
##Metadata-START##
Organism Display Name :: Spathaspora passalidarum NRRL Y-27907
GOLD Stamp ID :: Gi04859
##Metadata-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..300
/organism="Spathaspora passalidarum NRRL Y-27907"
/mol_type="mRNA"
/strain="NRRL Y-27907"
/type_material="type material of Spathaspora passalidarum"
/db_xref="taxon:619300"
/chromosome="Unknown"
gene <1..>300
/locus_tag="SPAPADRAFT_55114"
/db_xref="GeneID:18871909"
CDS 1..300
/locus_tag="SPAPADRAFT_55114"
/codon_start=1
/transl_table=12
/product="uncharacterized protein"
/protein_id="XP_007374716.1"
/db_xref="GeneID:18871909"
/db_xref="InterPro:IPR000509"
/db_xref="JGIDB:Spapa3_55114"
/translation="
MAKSGIAAGLNKGHKTTAKEVAPKVSYRKGALSKRADFVRNIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNKVIAESRRH"
misc_feature 7..294
/locus_tag="SPAPADRAFT_55114"
/note="Ribosomal protein L36e; Region: Ribosomal_L36e;
pfam01158"
/db_xref="CDD:460088"
ORIGIN
atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]