2024-05-05 23:56:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_005187320 600 bp mRNA linear INV 24-AUG-2023 DEFINITION PREDICTED: Musca domestica protein sisterless A-like (LOC101890048), mRNA. ACCESSION XM_005187320 VERSION XM_005187320.4 DBLINK BioProject: PRJNA1002374 KEYWORDS RefSeq; includes ab initio. SOURCE Musca domestica (house fly) ORGANISM Musca domestica Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Musca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026712238) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Aug 24, 2023 this sequence version replaced XM_005187320.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030504385.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/18/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..600 /organism="Musca domestica" /mol_type="mRNA" /strain="aabys" /db_xref="taxon:7370" /chromosome="Unknown" /sex="female" /tissue_type="Whole body" /dev_stage="adult" gene 1..600 /gene="LOC101890048" /note="protein sisterless A-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:101890048" CDS 1..600 /gene="LOC101890048" /codon_start=1 /product="protein sisterless A-like" /protein_id="XP_005187377.2" /db_xref="GeneID:101890048" /translation="
MEQYNSSRSTNLFLDPLYTSLTQELSLESLGPTTISSTQLNPQNIDQIVEMEMKRIQENIARKEAQYVEQMLVENPITFERRNNVTVLRKATSDSSLSPEQQRLQQQRADACRRSRYNNKVKKAKSKYRHKYISQKLQQSSQMLNCIKDLIAEAESHLLAQGLHKEKLHQLRSNYGIERPANIVRVDVNAVDFVLPTEP"
ORIGIN
atggaacaatataactccagccgctcaaccaatctcttcttggaccccctctacacatcgctgacacaagaattgtcattggaaagtttgggaccgacaacgatttcatcgacccaactaaatccgcaaaacatcgatcaaattgtcgaaatggaaatgaaacgcattcaggagaacatcgcccgtaaagaggcacagtatgtggaacaaatgttggtcgaaaatccaattacatttgaaagacgcaacaacgtcactgtgctaagaaaggcaacctcggacagctcattatcacccgaacaacaacggttgcagcagcaacgtgccgatgcatgtcgacgttctcgctacaacaacaaagtgaaaaaagccaagtcgaaatatcgccacaaatacatttcccagaaactccagcaaagcagtcagatgctgaattgtattaaggatctaattgccgaggctgaaagtcatttactcgcccaaggattgcacaaagagaagctgcatcaattgcgttcgaattatggcattgaaaggccagcaaatattgttcgtgttgacgtcaatgcagtagattttgttttgccaacggagccatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]