2024-04-24 05:18:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004284103 838 bp mRNA linear MAM 02-MAR-2023 DEFINITION PREDICTED: Orcinus orca BARX homeobox 1 (BARX1), mRNA. ACCESSION XM_004284103 VERSION XM_004284103.2 DBLINK BioProject: PRJNA854208 KEYWORDS RefSeq. SOURCE Orcinus orca (killer whale) ORGANISM Orcinus orca Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Delphinidae; Orcinus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064564) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Aug 2, 2022 this sequence version replaced XM_004284103.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_937001465.1-RS_2023_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/27/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..838 /organism="Orcinus orca" /mol_type="mRNA" /db_xref="taxon:9733" /chromosome="6" gene 1..838 /gene="BARX1" /note="BARX homeobox 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:101283461" CDS 1..765 /gene="BARX1" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="XP_004284151.1" /db_xref="GeneID:101283461" /translation="
MQRPGEPGAVRFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGLPGAAGAPHLPLELQLRGKLEAPGAGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKEAEKPAEAPGEAGDRSHED"
misc_feature order(427..441,445..447,496..498,514..516,553..555, 559..564,571..576,580..588,592..597) /gene="BARX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="BARX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="BARX1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
atgcagcggccgggggagccgggcgcagtgcgcttcggcccgcccgagggctgcgccgaccaccggccgcaccgctaccgcagcttcatgatcgaggaaatcctcactgagcctccggggcccaagggcgccgctcctgccgccgccgccgccgccgcgggcgagctgctcaagttcggcgtgcaggctctgctggcggcgcggcccttccacagccacctggccgtgctgaaggccgagcaggcggcggtgtttaagttcccgctggcgccgcttggctgctccgggttgggctcggcgctgcttgccgcggggcctgggctgcccggcgctgccggcgcgccgcacctgccgctcgagctgcagctccgcgggaagctggaggcgcctggcgccggggagccgggcaccaaggccaagaaggggcgtcggagccgcaccgtgttcaccgagctgcagctgatgggcctagagaaacgcttcgagaagcagaagtacctctccacgcccgacagaatagatctcgccgagtccctgggtctgagccagttgcaggtgaagacgtggtaccagaatcgaaggatgaagtggaagaaaatagtgctgcagggcggcggcctggagtctcccaccaagcccaaggggaggcccaagaagaactccatccccacgagcgaacagctcacggagcaggagcgcgccaaggaggcagagaagccggcggaggcgccgggcgaggccggcgaccggagccacgaggactgagcgcggcagagggttcgggcccagggaaccccagcgcagtccgcggcccccataacccgccggaagccgcgag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]