GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 15:13:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_004281745             912 bp    mRNA    linear   MAM 02-MAR-2023
DEFINITION  PREDICTED: Orcinus orca claudin 24 (CLDN24), mRNA.
ACCESSION   XM_004281745
VERSION     XM_004281745.3
DBLINK      BioProject: PRJNA854208
KEYWORDS    RefSeq.
SOURCE      Orcinus orca (killer whale)
  ORGANISM  Orcinus orca
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Delphinidae; Orcinus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064579) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 2, 2022 this sequence version replaced XM_004281745.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_937001465.1-RS_2023_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/27/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912
                     /organism="Orcinus orca"
                     /mol_type="mRNA"
                     /db_xref="taxon:9733"
                     /chromosome="21"
     gene            1..912
                     /gene="CLDN24"
                     /note="claudin 24; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 mRNAs, 7 Proteins"
                     /db_xref="GeneID:101270743"
     CDS             1..663
                     /gene="CLDN24"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="XP_004281793.1"
                     /db_xref="GeneID:101270743"
                     /translation="
MALVFRVAMQFVGILLSLLGWVLSIITTFLPHWKNLNLDLNEMENWTVGLWQTCVTQEEVGMQCKDFDSFLALPAELRISRILMFLSNGLGFLGLLVSGFGLDCLRIGERQQDVKKQLLILGGILFWTAGVTALVPVSWVAHRTVQEFWDETIPEIVPRWEFGEALFIGWFAGFSLLLGGCLLNWAACGTQIPLASGHYAVAEMQTQCSYLENGTANPSV"
     misc_feature    28..549
                     /gene="CLDN24"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
atggctttagtctttagagtagcaatgcaattcgttggaattttgctatctctgctgggatgggttttatccattattacaacttttttgccacattggaaaaacctcaacctggacttaaatgaaatggaaaactggaccgtgggactctggcagacctgcgtcacccaagaggaagtggggatgcaatgcaaggactttgattctttcctggctttgcccgctgagctcaggatctccaggattttaatgttcctctcaaacggcctgggattcctgggcctgctggtctcggggtttggcctggactgcttgagaattggagagagacagcaggatgtcaagaagcagctgttaatcctgggaggaattctgttctggacagcaggtgtcacagcccttgttcctgtctcttgggtcgcccacaggacagtccaggagttctgggatgagaccatccccgagattgtgcccaggtgggagtttggggaggccctctttatcggctggtttgctggattttctctcctgctcggagggtgtctgctaaactgggccgcctgcgggacccagattcccctggcttccggccactatgcagtggcagaaatgcaaactcagtgttcatacctggagaatggaactgccaatccttcagtgtaagactttgatgagaccagagaggtgtatctccctatatcaactgtgacggtctacatgataaagggttctttgttatgtaactatgtttgtgatgctaacattttctcattaaatacattaaatcatgacttttctatcctagataccccatccccccaaaacctggagaagtaagaaagaggcaaatcttatatctaaaagaaaatgattgtggtaagcattacataggaatgaacaaaacaaactttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]