2024-03-29 15:41:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004270268 1846 bp mRNA linear MAM 02-MAR-2023 DEFINITION PREDICTED: Orcinus orca claudin 6 (CLDN6), transcript variant X1, mRNA. ACCESSION XM_004270268 VERSION XM_004270268.4 DBLINK BioProject: PRJNA854208 KEYWORDS RefSeq. SOURCE Orcinus orca (killer whale) ORGANISM Orcinus orca Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Delphinidae; Orcinus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064574) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Aug 2, 2022 this sequence version replaced XM_004270268.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_937001465.1-RS_2023_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/27/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1846 /organism="Orcinus orca" /mol_type="mRNA" /db_xref="taxon:9733" /chromosome="16" gene 1..1846 /gene="CLDN6" /note="claudin 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 27 Proteins" /db_xref="GeneID:101288986" CDS 562..1227 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="XP_004270316.1" /db_xref="GeneID:101288986" /translation="
MASAGLQILGIVLTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLAGAKCTTCVEDKDSKARLVLISGIIFVISGVLTLIPVCWTAHTIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGSSHYMARYSASAPHTASRGPSEYPTKNYV"
misc_feature 574..1071 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atgccgggtcccgcccggacctctaagttcagttattcgctcaacaaacgccgtctctgtgcgggagcggccagaacgccaaagggatgcagatctggccctgccttctcggtgcggaagcccaggaggtgcatgttgggcgagagggcggatctgacacgaaacaacccagcacagagaaagctgtttcttaagggccccgaggactaaaatgaggctcgggaaggttaggtgagttccggagtcgagccccaagttctgttcggctccataccctgccccttgacccactgcttgccggacttcagccagttgatgccctgcacccgggccagatgggggagcagcggctccaggctcgagcgccccccactgacgaggttgggattcgcgcgtccgccgcggtctggactggggtctctgcccctcccctgggcggtggtccggtgacgtcattgcctctttaagacccccgcctccgccccagtcccagcactccgcctgctactccgaatcttggtggactcctttgcagtgcagctcctcaacctcaacctcaccatggcctctgctggtctgcaaatcctggggattgtcctgacactgcttggctgggtgaatgccctggtgtcctgtgccctgcccctgtggaaggtgaccgccttcatcggcaacagcattgtggtggcccaggtggtgtgggaggggctgtggatgtcctgcgtggtgcagagcactggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgcccgagccctctgtgtcatcactctcctagtggtcctgctcggcctgctggtctacctcgcaggggccaagtgcaccacctgtgtggaggacaaggactccaaggcccgtctggtgctcatctctgggatcatctttgtcatctcaggagtcctgaccctgatccccgtgtgctggactgcccacaccatcatccaggacttctacaaccccctggtggccgaggcccaaaagcgggagctgggagcctccctctacctgggctgggcagcttctggccttttgttgctgggtggggggctactgtgctgcacctgcccctctggggggtcccggggctccagccattatatggcccgatactcggcctcagccccgcatactgcctctcggggtccctctgagtaccccactaagaattacgtctaattcgggaaggggagcgtgggctcccttgagagtggagcctaaccctctgagctggagccatggcaatggtgatccatgacagctttggtgttgtttttgctttatattggtggggggcggtggttaatccatttgataacccacctgggctctgctactggcgttcctcacctttggatgatggagccaaagaggtgatgcttcagagtttctggatctttctccaccctggacacccccatcttagagaccaacctggagctttgggccccatgtgaagggtgcttgctatccaggtgctttcatcctgtccccgagagttcctgctgatgttgggggtaggacctccctaggcctgcagagacaagccttcccttgctggtcaggcctctggaacccccaggggcttttgagccacgtgtagcctctagaggagcaggtgataagttaccaaagacccacccacctccaagtcttctgacctctggcttctccatcctgagtcatgtcccccctgtgctgacccctgaccctcccatccccagcccctgtgcacttctgccatgtcctgcccacactcaccagtttttactaaataaagcacattttgtttggttac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]