2025-07-04 08:39:18, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_003813198 1234 bp mRNA linear PRI 06-MAR-2024 DEFINITION PREDICTED: Pan paniscus claudin 17 (CLDN17), mRNA. ACCESSION XM_003813198 VERSION XM_003813198.5 DBLINK BioProject: PRJNA950461 KEYWORDS RefSeq. SOURCE Pan paniscus (pygmy chimpanzee) ORGANISM Pan paniscus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_073271) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Jun 11, 2023 this sequence version replaced XM_003813198.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029289425.2-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/27/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1234 /organism="Pan paniscus" /mol_type="mRNA" /db_xref="taxon:9597" /chromosome="22" /sex="male" /cell_line="PR00251" /cell_type="fibroblast" /dev_stage="adult" gene 1..1234 /gene="CLDN17" /note="claudin 17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 Proteins" /db_xref="GeneID:100987641" CDS 189..863 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_003813246.1" /db_xref="GeneID:100987641" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQAYRYPVPGYCVPHTDKRRNTTMLSKTSTSYV"
misc_feature 204..734 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
atgcatttacaacaggtacttctagttaggccaagttcagtcacagctgctgatttggactaaaacgttatgggcagcagccaaggagaacatcatcaaagacttctctagaatcaagaggcttccacgttctacatcttgagcatcttctaccactccgaattgaaccagtcttcaaagtaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagctccttgttggctctcccgcctgccctggaaacagcccgggcccttatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatataatcatcagagatttctacaacccagccatccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaagcgtacagatatccagtgcctggctactgtgtgccacacacagataagcgaagaaacacgacaatgcttagtaagacctccactagttatgtctaatgcctccttttggctccaagtatggactatggtcaatgttttttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaattgatatgaaagtttcaatttgttactggtggtaggaatgaaaatgacttacttggacattctgacttcaggtgtattaaatgcattgactattgttggactcaatcgctgctccaattttcatattctaaattcaagtatacccataatcattagcaagtatacaatgatggactactactttttgaccatcatatattatctgataatctaaagttgaaattgatattctataacaataaaacatatacctattctaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]