GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-09 12:45:50, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_001391587             777 bp    mRNA    linear   PLN 21-FEB-2025
DEFINITION  Aspergillus niger uncharacterized protein (An07g05440), partial
            mRNA.
ACCESSION   XM_001391587
VERSION     XM_001391587.1
DBLINK      BioProject: PRJNA19263
            BioSample: SAMEA3283178
KEYWORDS    RefSeq.
SOURCE      Aspergillus niger
  ORGANISM  Aspergillus niger
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Circumdati.
REFERENCE   1  (bases 1 to 777)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NT_166523).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..777
                     /organism="Aspergillus niger"
                     /mol_type="mRNA"
                     /db_xref="taxon:5061"
                     /chromosome="IV"
                     /map="unlocalized"
                     /clone="An07"
     gene            <1..>777
                     /locus_tag="An07g05440"
                     /db_xref="GeneID:4981811"
     CDS             1..777
                     /locus_tag="An07g05440"
                     /EC_number="1.1.1.-"
                     /inference="profile:COGS:COG1028"
                     /inference="profile:PFAM:PF00106"
                     /note="Function: maleylacetate reductases contribute to
                     the bacterial catabolism of some usual aromatic compounds
                     like quinol or resorcinol and also to the degradation of
                     aromatic compounds carrying unusual substituents, such as
                     halogen atoms or nitro groups.;
                     Similarity: the ORF shows similarity to several
                     short-chain dehydrogenase/reductase from different species
                     and with various function, most of which are
                     3-oxoacyl-(acyl carrier protein) reductases, that are
                     involved in fatty acid biosynthesis (EC 1. 1. 1. 100).;
                     Title: strong similarity to maleylacetate reductase macA -
                     Rhodococcus opacus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001391624.1"
                     /db_xref="GeneID:4981811"
                     /db_xref="GOA:A2QNF1"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:A2QNF1"
                     /translation="
MSSGSYNYNKLAGKHVLIFGGTSGIGLGVAKLSLAASAKVTVSSSSSKRIESTVQDLKSEFPNAQLQGHVCDLSKDTIEEDFEALFQKTNQVDHIVFTATDAPAIMPVQEITREKLIAAGQVRFFAAVLVAKIGSRYLSPGPDSSITLTTGTNWEHPMPNWTAVAGYLGGTCSVVCNLAVDLKPIRVNAVSPGLVKTPLWNNLMSEEEQEKICQFSAAKNPTGRVAQPEEVAEAYLYLMKDTNITGRIVSTDSGALLV"
     misc_feature    49..774
                     /locus_tag="An07g05440"
                     /note="SDR family oxidoreductase; Region: PRK07041"
                     /db_xref="CDD:235914"
ORIGIN      
atgtcctccggcagctacaactacaataaactcgcgggcaagcatgtcctgattttcggaggcacctccggcataggcctgggtgtggccaagctttcactagccgcatcagccaaagtcactgtgtcttcatcctcaagcaaacgcattgaatccaccgtccaggatctcaagtcggaattcccaaatgcccagctccaaggacacgtctgcgatctttccaaagacacgatcgaagaagacttcgaagcgctattccaaaagaccaaccaagttgatcacattgttttcaccgcaaccgatgcgccagccatcatgcccgtgcaagaaatcactcgggagaagctcatcgctgccggtcaagtgcgctttttcgcggccgtactcgtcgccaagattggctctcgatacctctccccgggtccggattcatcaattaccttgacgacaggaactaattgggaacatccgatgcccaactggacggcggtagctggatacttaggtggtacttgcagtgttgtgtgtaatctagcggtggatttgaagccgatacgtgttaacgctgtgagtcctggactggtgaaaactcccctatggaacaatctgatgagtgaagaggagcaagaaaagatatgccagttttccgcagcgaaaaatccgacgggaagggttgctcagccggaagaagtggcagaggcttatctatatttgatgaaggatacgaacattaccgggcggatagtgagtacggattcgggtgctttacttgtttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]