2025-07-04 08:37:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_001100305 1528 bp mRNA linear PRI 26-APR-2019 DEFINITION PREDICTED: Macaca mulatta claudin 17 (CLDN17), mRNA. ACCESSION XM_001100305 VERSION XM_001100305.4 DBLINK BioProject: PRJNA528504 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041756.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Apr 23, 2019 this sequence version replaced XM_001100305.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Macaca mulatta Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1528 /organism="Macaca mulatta" /mol_type="mRNA" /isolate="AG07107" /bio_material="Coriell:AG07107" /db_xref="taxon:9544" /chromosome="3" /sex="female" /tissue_type="fibroblast" gene 1..1528 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:705582" CDS 457..1131 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_001100305.1" /db_xref="GeneID:705582" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANVIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV"
misc_feature 472..1002 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ttcagctgtgccttaacacatatatttatacttttatatcagagtgattttttacacaggaagtttcagctctgtaattagcaattcacaatggaaactttgacacttaattacagcattgctaagacaataataatgtgagaaatcctaaagctgaatgcagtatttcttgacacacccctagctaccttcttattggctgggaaacaattatatatgactagtaaataatccatagagaaatgaatgtgtatgaaaaaaggcaacatgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacgttctacatcttgagcatcttctaccactccgaattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacgacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaagtccagtgcacgggctctaatgagagggccaaagcatatcttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatgtaatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaattgatatgaaagtttcaatttgttactggtaggaaaacttggacattctgacttcaggtgtattaaatgcatttactattgttggactcaatcgctgttccaatgttcatattctaaatgtaagtatacccataatcattatcaagtgcacaatgatggactactagtttttgaccatcatattttatctgataagaatcaaaatttgaaatcgatattctataacaataaaacatatacctattctaaaatgtaagctattatttttcctctacattgtttcttgta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]