GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 19:21:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_026509               2062 bp    mRNA    linear   ROD 05-AUG-2023
DEFINITION  Mus musculus caveolae associated 4 (Cavin4), mRNA.
ACCESSION   NM_026509
VERSION     NM_026509.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2062)
  AUTHORS   Lo HP, Lim YW, Xiong Z, Martel N, Ferguson C, Ariotti N, Giacomotto
            J, Rae J, Floetenmeyer M, Moradi SV, Gao Y, Tillu VA, Xia D, Wang
            H, Rahnama S, Nixon SJ, Bastiani M, Day RD, Smith KA, Palpant NJ,
            Johnston WA, Alexandrov K, Collins BM, Hall TE and Parton RG.
  TITLE     Cavin4 interacts with Bin1 to promote T-tubule formation and
            stability in developing skeletal muscle
  JOURNAL   J Cell Biol 220 (12) (2021)
   PUBMED   34633413
  REMARK    GeneRIF: Cavin4 interacts with Bin1 to promote T-tubule formation
            and stability in developing skeletal muscle.
REFERENCE   2  (bases 1 to 2062)
  AUTHORS   Nishi M, Ogata T, Cannistraci CV, Ciucci S, Nakanishi N, Higuchi Y,
            Sakamoto A, Tsuji Y, Mizushima K and Matoba S.
  TITLE     Systems Network Genomic Analysis Reveals Cardioprotective Effect of
            MURC/Cavin-4 Deletion Against Ischemia/Reperfusion Injury
  JOURNAL   J Am Heart Assoc 8 (15), e012047 (2019)
   PUBMED   31364493
  REMARK    GeneRIF: Systems Network Genomic Analysis Reveals Cardioprotective
            Effect of MURC/Cavin-4 Deletion Against Ischemia/Reperfusion
            Injury.
REFERENCE   3  (bases 1 to 2062)
  AUTHORS   Miyagawa K, Ogata T, Ueyama T, Kasahara T, Nakanishi N, Naito D,
            Taniguchi T, Hamaoka T, Maruyama N, Nishi M, Kimura T, Yamada H,
            Aoki H and Matoba S.
  TITLE     Loss of MURC/Cavin-4 induces JNK and MMP-9 activity enhancement in
            vascular smooth muscle cells and exacerbates abdominal aortic
            aneurysm
  JOURNAL   Biochem Biophys Res Commun 487 (3), 587-593 (2017)
   PUBMED   28433630
  REMARK    GeneRIF: The MURC/Cavin-4 in vascular smooth muscle cells modulates
            abdominal aortic aneurysm (AAA) progression at the early stage via
            the activation of JNK and MMP-9. MURC/Cavin-4 is a potential
            therapeutic target against AAA progression.
REFERENCE   4  (bases 1 to 2062)
  AUTHORS   Bang ML.
  TITLE     Animal Models of Congenital Cardiomyopathies Associated With
            Mutations in Z-Line Proteins
  JOURNAL   J Cell Physiol 232 (1), 38-52 (2017)
   PUBMED   27171814
  REMARK    Review article
REFERENCE   5  (bases 1 to 2062)
  AUTHORS   Nakanishi N, Ogata T, Naito D, Miyagawa K, Taniguchi T, Hamaoka T,
            Maruyama N, Kasahara T, Nishi M, Matoba S and Ueyama T.
  TITLE     MURC deficiency in smooth muscle attenuates pulmonary hypertension
  JOURNAL   Nat Commun 7, 12417 (2016)
   PUBMED   27546070
  REMARK    GeneRIF: MURC binds to Cav1 and inhibits the association of Cav1
            with the active form of Galpha13, resulting in the facilitated
            association of the active form of Galpha13 with p115RhoGEF. These
            results reveal that MURC has a function in the development of
            pulmonary hypertension through modulating Rho/ROCK signaling.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2062)
  AUTHORS   Ogata T, Naito D, Nakanishi N, Hayashi YK, Taniguchi T, Miyagawa K,
            Hamaoka T, Maruyama N, Matoba S, Ikeda K, Yamada H, Oh H and Ueyama
            T.
  TITLE     MURC/Cavin-4 facilitates recruitment of ERK to caveolae and
            concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors
  JOURNAL   Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014)
   PUBMED   24567387
  REMARK    GeneRIF: MURC/Cavin-4 facilitates recruitment of ERK to caveolae
            and concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors.
REFERENCE   7  (bases 1 to 2062)
  AUTHORS   Ludwig A, Howard G, Mendoza-Topaz C, Deerinck T, Mackey M, Sandin
            S, Ellisman MH and Nichols BJ.
  TITLE     Molecular composition and ultrastructure of the caveolar coat
            complex
  JOURNAL   PLoS Biol 11 (8), e1001640 (2013)
   PUBMED   24013648
REFERENCE   8  (bases 1 to 2062)
  AUTHORS   Bastiani M, Liu L, Hill MM, Jedrychowski MP, Nixon SJ, Lo HP,
            Abankwa D, Luetterforst R, Fernandez-Rojo M, Breen MR, Gygi SP,
            Vinten J, Walser PJ, North KN, Hancock JF, Pilch PF and Parton RG.
  TITLE     MURC/Cavin-4 and cavin family members form tissue-specific caveolar
            complexes
  JOURNAL   J Cell Biol 185 (7), 1259-1273 (2009)
   PUBMED   19546242
  REMARK    GeneRIF: Data show that MURC/Cavin-4 forms a multiprotein complex
            that associates with caveolae, and identify Cavin-4 as a novel
            muscle disease candidate caveolar protein.
REFERENCE   9  (bases 1 to 2062)
  AUTHORS   Tagawa M, Ueyama T, Ogata T, Takehara N, Nakajima N, Isodono K,
            Asada S, Takahashi T, Matsubara H and Oh H.
  TITLE     MURC, a muscle-restricted coiled-coil protein, is involved in the
            regulation of skeletal myogenesis
  JOURNAL   Am J Physiol Cell Physiol 295 (2), C490-C498 (2008)
   PUBMED   18508909
  REMARK    GeneRIF: findings suggest that MURC is involved in the skeletal
            myogenesis that results from modulation of myogenin expression and
            ERK activation; MURC may play pivotal roles in the molecular
            mechanisms of skeletal myogenic differentiation
REFERENCE   10 (bases 1 to 2062)
  AUTHORS   Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T,
            Harada K, Takahashi T, Shioi T, Matsubara H and Oh H.
  TITLE     MURC, a muscle-restricted coiled-coil protein that modulates the
            Rho/ROCK pathway, induces cardiac dysfunction and conduction
            disturbance
  JOURNAL   Mol Cell Biol 28 (10), 3424-3436 (2008)
   PUBMED   18332105
  REMARK    GeneRIF: MURC modulates RhoA signaling, and MURC plays an important
            role in the development of cardiac dysfunction and conduction
            disturbance with increased vulnerability to atrial arrhythmias.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC089601.1 and AL807771.6.
            
            On Mar 21, 2009 this sequence version replaced NM_026509.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC089601.1, AK009691.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1342              BC089601.1         1-1342
            1343-1343           AL807771.6         44119-44119
            1344-2062           BC089601.1         1344-2062
FEATURES             Location/Qualifiers
     source          1..2062
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="4"
                     /map="4 26.23 cM"
     gene            1..2062
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="caveolae associated 4"
                     /db_xref="GeneID:68016"
                     /db_xref="MGI:MGI:1915266"
     exon            1..516
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    94..96
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="upstream in-frame stop codon"
     CDS             109..1197
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="muscle-restricted coiled-coil protein; cavin 4;
                     muscle-related coiled-coil protein"
                     /codon_start=1
                     /product="caveolae-associated protein 4"
                     /protein_id="NP_080785.2"
                     /db_xref="CCDS:CCDS18169.2"
                     /db_xref="GeneID:68016"
                     /db_xref="MGI:MGI:1915266"
                     /translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
     misc_feature    109..180
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    187..897
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237"
                     /db_xref="CDD:434559"
     misc_feature    562..564
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    619..621
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    622..624
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    796..975
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1021..1146
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1078..1080
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    1108..1110
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    1165..1167
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     exon            517..2044
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gttttcaaccctttaaagcagctccgttgcctgcttcctagccgacttttggctccaggcgtaggaaccggattgccataggacaccttctgctgagaaaaaagtaaaatggaacacaacggatcagcttcaaatgctggtaaaatccaccagaatcggttgtcaagtgtgacggaagatgaagaccaagacgcagccctcaccattgtgaccgtgctggacagagtggccagtgtcgtggacagtgtgcaggcaagccagaagagaattgaggagagacacagagaaatgggtaacgcgataaagtctgtccaaatagacctgctgaagctctcacagtcacacagcaatacgggctacgttgtcaacaagctgtttgagaagacccggaaagtcagcgctcacattaaggatgtcaaggcccgggtagagaagcaacaggttcgtgtaaccaaagtcgaaaccaagcaagaagaaataatgaagaaaaacaaattccgagtggtaatcttccaggaggacattccctgccccgcatccctgtctgttgttaaagacagaagcctgcccgagaaccaggaggaggccgaagaagtcttcgatcccccaatagagctctcctcggatgaggagtattatgttgaagaaagcagatctgccaggcttaggaagtcaggcaaagagcacattgaccacatcaagaaagccttttccagagaaaacatgcagaagacacggcagactcttgacaagaaagtgagtgggattagaactaggatagtcactcctgagaggagagagaggctgaggcagtcgggagagaggctgaggcagtcaggagagaggctgaggcagtcgggggaaagatttaagaaatcgatttccagtgccgctccctcaaaggaagcttttaagattcggagccttaggaaagcgaaggatcccaaggccgagggccaggaggtagacagagggatgggcgtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgagttcagtgaaacagaaaaggaggtgaccaaaggagggtacagtccccaagaaggaggggaccccccaacgcctgagcctttgaaggtgacttttaaaccccaggtgagggtagaggatgacgagtcactcctgttggagctaaagcagtcctcatagaggatttaagtacgagcatccatcacttggaatcatgtggttgtagtttgaatggtgtggtattcatattcatttatattcatccgcagtggaaaggcagatggtagaaaagcttcatttcttacctctaaaatcctaaagatgctggaaatattatatacaatttttgtacaatttccttgggaattctattcccctgagaatatatgactctgacagcaccccacccctgtctgcctacccccttacgtcatgccttttcgtggcagctcttggccaatgagaaaatagttgcacggctctggtcagttagatgatatgccattcataacacaggaacaacggatctgtgtccgttgttcatcagcaaactctagatctgggtcaggattgacacatccagtcaagaaggggagtagctgatgagtacatcgtgttatccagatgttcacatctggagattcattagtgagtcagtagccttatgaaggttacaaagttcttgtgtgagggaaaggaaatggaagtctgggacttgaacattttagctgcggcaacataactttattctagtgagatacttggctggttgccacatattctcaatgctaaaatgaaaaaaagggcttgctcttcctgtacttcttggagaacttgagatctgaggtggtgtcacagagtttgtgagaacaagacacacgacaagtggagaagcccacaaatcgcactggctcccctaacacagaatggaaacagttacatctgtgaggaagccctcggcacaggctccaaggccagagctgagcggaaactggggtggttcacaagtcttcacggaataaagagtaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]