2025-04-04 14:12:28, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS NM_001424231 1003 bp mRNA linear PRI 22-SEP-2024 DEFINITION Homo sapiens elongator acetyltransferase complex subunit 6 (ELP6), transcript variant 23, mRNA. ACCESSION NM_001424231 VERSION NM_001424231.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1003) AUTHORS Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R., Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S., Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A., Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R., Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P., Harper,J.W. and Gygi,S.P. TITLE Dual proteome-scale networks reveal cell-specific remodeling of the human interactome JOURNAL Cell 184 (11), 3022-3040 (2021) PUBMED 33961781 REFERENCE 2 (bases 1 to 1003) AUTHORS Kojic,M. and Wainwright,B. TITLE The Many Faces of Elongator in Neurodevelopment and Disease JOURNAL Front Mol Neurosci 9, 115 (2016) PUBMED 27847465 REMARK Review article Publication Status: Online-Only REFERENCE 3 (bases 1 to 1003) AUTHORS Arking,D.E., Pulit,S.L., Crotti,L., van der Harst,P., Munroe,P.B., Koopmann,T.T., Sotoodehnia,N., Rossin,E.J., Morley,M., Wang,X., Johnson,A.D., Lundby,A., Gudbjartsson,D.F., Noseworthy,P.A., Eijgelsheim,M., Bradford,Y., Tarasov,K.V., Dorr,M., Muller-Nurasyid,M., Lahtinen,A.M., Nolte,I.M., Smith,A.V., Bis,J.C., Isaacs,A., Newhouse,S.J., Evans,D.S., Post,W.S., Waggott,D., Lyytikainen,L.P., Hicks,A.A., Eisele,L., Ellinghaus,D., Hayward,C., Navarro,P., Ulivi,S., Tanaka,T., Tester,D.J., Chatel,S., Gustafsson,S., Kumari,M., Morris,R.W., Naluai,A.T., Padmanabhan,S., Kluttig,A., Strohmer,B., Panayiotou,A.G., Torres,M., Knoflach,M., Hubacek,J.A., Slowikowski,K., Raychaudhuri,S., Kumar,R.D., Harris,T.B., Launer,L.J., Shuldiner,A.R., Alonso,A., Bader,J.S., Ehret,G., Huang,H., Kao,W.H., Strait,J.B., Macfarlane,P.W., Brown,M., Caulfield,M.J., Samani,N.J., Kronenberg,F., Willeit,J., Smith,J.G., Greiser,K.H., Meyer Zu Schwabedissen,H., Werdan,K., Carella,M., Zelante,L., Heckbert,S.R., Psaty,B.M., Rotter,J.I., Kolcic,I., Polasek,O., Wright,A.F., Griffin,M., Daly,M.J., Arnar,D.O., Holm,H., Thorsteinsdottir,U., Denny,J.C., Roden,D.M., Zuvich,R.L., Emilsson,V., Plump,A.S., Larson,M.G., O'Donnell,C.J., Yin,X., Bobbo,M., D'Adamo,A.P., Iorio,A., Sinagra,G., Carracedo,A., Cummings,S.R., Nalls,M.A., Jula,A., Kontula,K.K., Marjamaa,A., Oikarinen,L., Perola,M., Porthan,K., Erbel,R., Hoffmann,P., Jockel,K.H., Kalsch,H., Nothen,M.M., den Hoed,M., Loos,R.J., Thelle,D.S., Gieger,C., Meitinger,T., Perz,S., Peters,A., Prucha,H., Sinner,M.F., Waldenberger,M., de Boer,R.A., Franke,L., van der Vleuten,P.A., Beckmann,B.M., Martens,E., Bardai,A., Hofman,N., Wilde,A.A., Behr,E.R., Dalageorgou,C., Giudicessi,J.R., Medeiros-Domingo,A., Barc,J., Kyndt,F., Probst,V., Ghidoni,A., Insolia,R., Hamilton,R.M., Scherer,S.W., Brandimarto,J., Margulies,K., Moravec,C.E., del Greco,M. F, Fuchsberger,C., O'Connell,J.R., Lee,W.K., Watt,G.C., Campbell,H., Wild,S.H., El Mokhtari,N.E., Frey,N., Asselbergs,F.W., Mateo Leach,I., Navis,G., van den Berg,M.P., van Veldhuisen,D.J., Kellis,M., Krijthe,B.P., Franco,O.H., Hofman,A., Kors,J.A., Uitterlinden,A.G., Witteman,J.C., Kedenko,L., Lamina,C., Oostra,B.A., Abecasis,G.R., Lakatta,E.G., Mulas,A., Orru,M., Schlessinger,D., Uda,M., Markus,M.R., Volker,U., Snieder,H., Spector,T.D., Arnlov,J., Lind,L., Sundstrom,J., Syvanen,A.C., Kivimaki,M., Kahonen,M., Mononen,N., Raitakari,O.T., Viikari,J.S., Adamkova,V., Kiechl,S., Brion,M., Nicolaides,A.N., Paulweber,B., Haerting,J., Dominiczak,A.F., Nyberg,F., Whincup,P.H., Hingorani,A.D., Schott,J.J., Bezzina,C.R., Ingelsson,E., Ferrucci,L., Gasparini,P., Wilson,J.F., Rudan,I., Franke,A., Muhleisen,T.W., Pramstaller,P.P., Lehtimaki,T.J., Paterson,A.D., Parsa,A., Liu,Y., van Duijn,C.M., Siscovick,D.S., Gudnason,V., Jamshidi,Y., Salomaa,V., Felix,S.B., Sanna,S., Ritchie,M.D., Stricker,B.H., Stefansson,K., Boyer,L.A., Cappola,T.P., Olsen,J.V., Lage,K., Schwartz,P.J., Kaab,S., Chakravarti,A., Ackerman,M.J., Pfeufer,A., de Bakker,P.I. and Newton-Cheh,C. CONSRTM CARe Consortium; COGENT Consortium; DCCT/EDIC; eMERGE Consortium; HRGEN Consortium TITLE Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization JOURNAL Nat Genet 46 (8), 826-836 (2014) PUBMED 24952745 REFERENCE 4 (bases 1 to 1003) AUTHORS Wagner,L.A., Wang,S., Wayner,E.A., Christensen,C., Perkins,S.J., Ward,G.W., Weiss,R.B., Dunn,D.M., Redd,M.J., Spangrude,G.J. and Gleich,G.J. TITLE Developing and mature human granulocytes express ELP 6 in the cytoplasm JOURNAL Hum Antibodies 22 (1-2), 21-29 (2013) PUBMED 24284306 REMARK GeneRIF: ELP6 is expressed intracellularly in developing and mature granulocytes and monocytes but not in lymphocytes and erythrocytes. REFERENCE 5 (bases 1 to 1003) AUTHORS Close,P., Gillard,M., Ladang,A., Jiang,Z., Papuga,J., Hawkes,N., Nguyen,L., Chapelle,J.P., Bouillenne,F., Svejstrup,J., Fillet,M. and Chariot,A. TITLE DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator JOURNAL J Biol Chem 287 (39), 32535-32545 (2012) PUBMED 22854966 REMARK GeneRIF: data identify DERP6/ELP5 and C3ORF75/ELP6 as key players for migration, invasion and tumorigenicity of melanoma cells, as integral subunits of Elongator. REFERENCE 6 (bases 1 to 1003) AUTHORS Bolukbasi,E., Vass,S., Cobbe,N., Nelson,B., Simossis,V., Dunbar,D.R. and Heck,M.M. TITLE Drosophila poly suggests a novel role for the Elongator complex in insulin receptor-target of rapamycin signalling JOURNAL Open Biol 2 (1), 110031 (2012) PUBMED 22645656 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC099778.2. ##Evidence-Data-START## Transcript exon combination :: SRR18074968.360634.1, SRR14038197.2088112.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA1965299, SAMEA1966682 [ECO:0006172] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-176 AC099778.2 158054-158229 c 177-255 AC099778.2 155665-155743 c 256-326 AC099778.2 154701-154771 c 327-445 AC099778.2 148847-148965 c 446-1003 AC099778.2 140157-140714 c FEATURES Location/Qualifiers source 1..1003 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="3" /map="3p21.31" gene 1..1003 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /note="elongator acetyltransferase complex subunit 6" /db_xref="GeneID:54859" /db_xref="HGNC:HGNC:25976" /db_xref="MIM:615020" exon 1..176 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /inference="alignment:Splign:2.1.0" misc_feature 105..107 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /note="upstream in-frame stop codon" CDS 123..449 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /note="isoform 12 is encoded by transcript variant 23; transmembrane protein 103; angiotonin-transactivated protein 1; UPF0405 protein C3orf75; elongator complex protein 6 homolog" /codon_start=1 /product="elongator complex protein 6 isoform 12" /protein_id="NP_001411160.1" /db_xref="GeneID:54859" /db_xref="HGNC:HGNC:25976" /db_xref="MIM:615020" /translation="
MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYSIVGQKLGVSLTMARERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLS"
exon 177..255 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /inference="alignment:Splign:2.1.0" exon 256..326 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /inference="alignment:Splign:2.1.0" exon 327..445 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /inference="alignment:Splign:2.1.0" exon 446..1003 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /inference="alignment:Splign:2.1.0" regulatory 980..985 /regulatory_class="polyA_signal_sequence" /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /note="hexamer: AATAAA" polyA_site 1003 /gene="ELP6" /gene_synonym="C3orf75; TMEM103" /note="major polyA site" ORIGIN
ggcattgcgcatgcgcgcttccttgcgcgagccgggctgtcgggtgtgttttgctctccagcctccgtcgtctctgcagcactccgggttctcctccagagcgctagtcccaggagctcggaatgttcgtggaacttaataacctgcttaacaccacccccgacagggcggagcaggggaaactgactctactctgtgatgccaagacagatgggagtttccttgtacaccactttctctccttctatctcaaagctaattgtaaagtctgctttgtggcactcatccagtccttcagccactacagtatcgtgggacagaagctgggtgtcagcctgaccatggcgcgggagcgtgggcagcttgtgttccttgagggactcaagtctgcagtggacgtcgtcttccaggctcaaaaggagccacaccccctgcagtttctcagctgaggatcctgtggaggagaccatcgcagcccgcagtccaccgggatcagagcttcacttaccagtataagatacaggacaaaagcgtgtccttttttgccaaaggaatgtctcctgctgttctgtgacctgatttcggagcagctgaagctacataggactgtttttggacgtggaagatagagcaacatagcaagaatgggtctttctcctctgtagtaatatttcaggctggaccggcgactccactgtgaccagagggttgagtgctgcagtgatggcatgccttggctgccctgggccctgttcagaaaacacaagggaccacaatcctgcctttgctgagagagaggctggatgctagacccaagtgaaaggggtcctttggagcctttgtttaaatatgccttagccccagctgcccatttttggttgacaagcctttcagagccagagtgggtatagatgtgccagccaggagatggcaccggatggcaggtgtgcaaggtgacaactaggataatcatggctggaataaagtaagtttccacactgga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]