2024-03-29 23:26:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001200921 957 bp mRNA linear VRT 04-MAY-2019 DEFINITION Ictalurus punctatus claudin-4 (cld4), mRNA. ACCESSION NM_001200921 VERSION NM_001200921.1 KEYWORDS RefSeq. SOURCE Ictalurus punctatus (channel catfish) ORGANISM Ictalurus punctatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Ictaluridae; Ictalurus. REFERENCE 1 (bases 1 to 957) AUTHORS Chen F, Lee Y, Jiang Y, Wang S, Peatman E, Abernathy J, Liu H, Liu S, Kucuktas H, Ke C and Liu Z. TITLE Identification and characterization of full-length cDNAs in channel catfish (Ictalurus punctatus) and blue catfish (Ictalurus furcatus) JOURNAL PLoS ONE 5 (7), e11546 (2010) PUBMED 20634964 REMARK Publication Status: Online-Only COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from GU589254.1. ##Evidence-Data-START## Transcript exon combination :: GU589254.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..957 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="18" /map="18" gene 1..957 /gene="cld4" /note="claudin-4" /db_xref="GeneID:100528651" exon 1..942 /gene="cld4" /inference="alignment:Splign:2.0.8" misc_feature 21..23 /gene="cld4" /note="upstream in-frame stop codon" CDS 51..686 /gene="cld4" /codon_start=1 /product="claudin-4" /protein_id="NP_001187850.1" /db_xref="GeneID:100528651" /translation="
MVSQGLQILGVMLSMTGWLGTIITCALPMWRVTAFIGANIVTAQVIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARAMVIISIIVGIFGVLMAVIGGKCTNCMEDESAKAKACIVSGVIFLIAAFLILIPVSWSAQTLIRDFYNPLVLEAQRRELGACLYIGWGSAALLLLGGGLLCWNCPPKENQQYTAAKFAPARSFSPGMNYV"
misc_feature 63..566 /gene="cld4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
acatttccggaactatcccatgaagcactgattgcagactatccagaacaatggtatcccaaggcctccagatcctgggtgttatgctgtctatgacagggtggctggggacaatcattacctgtgctctgcctatgtggagagtgacggctttcattggagctaacattgtcacagcgcaggtcatctgggagggtttatggatgaactgtgtggttcagagtactggacagatgcagtgtaaggtctacgactccctgctggcccttcctcaagaccttcaagcggcccgagccatggtcatcatctccatcattgtgggcatctttggtgtgctaatggctgtgattggaggaaagtgtactaactgcatggaggatgaatcagcaaaagctaaagcttgcattgtctcaggggtgatctttcttattgctgccttcctcatcctaatacctgtgagttggtctgcccagacccttatcagggacttctacaaccccttggtgttagaagcccagcgtcgagagttaggagcttgcctgtatattggctggggttctgcggctctcctgctgctggggggagggctgctttgctggaattgccctccgaaggagaaccagcagtatacagcagccaaatttgcacctgctagatccttttccccagggatgaattatgtgtgagcaaaacggtgaatgtttccatgagaactctgaacaaaagtggattcatctaccatattaactatgtatctggaaaggcatgtatttcttttcttttgcgaccacgtatattttcctattacatgattacagatctttgataataatgagatggatgcttgttttaataaatgaatgtgaacaaattctgtacatggaaattcggtgattgaaaatctttttcatttgacattttgtaattaaaagtctgtgaaacggaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]