LOCUS       NM_001198174            1269 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana Homeobox-leucine zipper protein family
            (ATHB54), mRNA.
ACCESSION   NM_001198174
VERSION     NM_001198174.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1269)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 1269)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1269)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1269)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 1269)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            
            On Sep 12, 2016 this sequence version replaced NM_001198174.1.
FEATURES             Location/Qualifiers
     source          1..1269
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            1..1269
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="Encodes ATHB54, a member of the homeodomain leucine
                     zipper (HD-Zip) family protein. Please note that this
                     locus was split from AT1G27050 in the TAIR10 genome
                     release (2010). Affymetrix ATH1 Probe Set linked to symbol
                     ATHB54 is in fact directed against the product of the
                     AT1G27050 locus (the mRNA coding for the
                     RNA-recognition-motif protein)."
                     /db_xref="Araport:AT1G27045"
                     /db_xref="GeneID:10723019"
                     /db_xref="TAIR:AT1G27045"
     CDS             285..968
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="Homeobox-leucine zipper protein family; FUNCTIONS
                     IN: sequence-specific DNA binding, transcription regulator
                     activity, DNA binding, sequence-specific DNA binding
                     transcription factor activity; INVOLVED IN: regulation of
                     transcription, DNA-dependent, regulation of transcription;
                     LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox
                     (InterPro:IPR001356), Homeobox, conserved site
                     (InterPro:IPR017970), Helix-turn-helix motif, lambda-like
                     repressor (InterPro:IPR000047), Homeodomain-like
                     (InterPro:IPR009057), Leucine zipper, homeobox-associated
                     (InterPro:IPR003106), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: homeobox 1 (TAIR:AT3G01470.1)."
                     /codon_start=1
                     /product="Homeobox-leucine zipper protein family"
                     /protein_id="NP_001185103.1"
                     /db_xref="Araport:AT1G27045"
                     /db_xref="GeneID:10723019"
                     /db_xref="TAIR:AT1G27045"
                     /translation="

MENSDTDSEVFFWFQNQNQNHSHKFPSSCFPPSSHSAFYGSSSMINTETATMDEEDVCESYMMREITKKRKLTPIQLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYKTKQLEHDCDSLKASYAKLKTDWDILFVQNQTLKSKVDLLKEKLKMQENLETQSIERKRLGEEGSSVKSDNTQYSEEEGLENQYSFPELAVLGFYYDPTLTASNLRL"

     misc_feature    order(486..494,498..500,549..551,567..569,606..608,
                     612..617,624..629,633..641,645..650)
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    486..647
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(486..488,495..497,615..617,624..629,636..638)
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    651..776
                     /gene="ATHB54"
                     /locus_tag="AT1G27045"
                     /gene_synonym="HB54; homeobox protein 54"
                     /note="Homeobox associated leucine zipper; Region: HALZ;
                     pfam02183"
                     /db_xref="CDD:426641"
ORIGIN      

gagagcatctccaatccaacttgcgaaatcattcacaccatttaaaaaacaaaaatcacacctattgaatggaaaaatgtaaaatcaatcaccttaataattattaaccacaagtataatccctattatagcaaaacagcacattcgtctccttcttcttaccagacactaaaacaagcaaaaggaatcgttttttctttctcttgtaacttttatgtttcgtcattctacaatttcttctttataaaaagtgactcttaagagtcccaacattttcagtaaaaatggaaaactcagacactgattcagaagttttcttttggtttcagaaccaaaaccaaaaccatagccataagtttccttcttcttgttttcctccgagctctcactctgctttttatggatctagctcaatgatcaacacagagactgcaactatggacgaagaagacgtatgtgagagctacatgatgcgtgagataaccaagaaacggaagctaacaccgatccaattgcgtttactagaggagagtttcgaagaagagaaaagactcgaaccagacaggaaactctggctagccgagaagctagggctgcagccaagccaagtcgctgtctggttccaaaacagaagagctagatacaagaccaaacagctcgaacacgactgtgactctcttaaagctagctatgctaagctcaagactgactgggacattctctttgtacaaaaccaaaccctcaagagcaaggtcgatcttctcaaagagaagctgaaaatgcaagagaatcttgaaactcagtctattgagaggaaaagacttggggaagaaggtagttcggtgaaaagcgataacacgcagtacagtgaagaagaaggtttggagaatcaatacagtttcccggagcttgcagttctcggattttattatgatccaaccttaactgcttcaaatctaaggttgtgatagtgtaggtcaacaacgttccgtgtgcctcaagttatcttcgctgtctccatcctttttatcttagacttcatattctaagaaagaaagcagtaataatattcattgatggaataaaaatgcattgtaatttaagtcgttaagttatatgaactttttatgaaaatggaaaaggtcacaaggccatattttcagtgactagataaatgaaaagtgcatgcttttcaaatgatatggacgttttggtatttacctcaataattcgtatgctacattttcatataaaccaagagaacctcga

//