GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 00:45:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001161636             893 bp    mRNA    linear   MAM 20-FEB-2022
DEFINITION  Sus scrofa claudin 5 (CLDN5), mRNA.
ACCESSION   NM_001161636
VERSION     NM_001161636.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 893)
  AUTHORS   Dalmasso AP, Goldish D, Benson BA, Tsai AK, Wasiluk KR and
            Vercellotti GM.
  TITLE     Interleukin-4 induces up-regulation of endothelial cell claudin-5
            through activation of FoxO1: role in protection from
            complement-mediated injury
  JOURNAL   J Biol Chem 289 (2), 838-847 (2014)
   PUBMED   24280217
  REMARK    GeneRIF: Data show that IL-4 induces upregulation of the junction
            protein claudin-5 in endothelial cells (ECs) through activation of
            Jak/STAT6 and phosphorylation and translocation of FoxO1 from the
            nucleus to the cytoplasm.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ873112.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: FJ873112.1, CJ032030.1 [ECO:0000345]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..893
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="14"
                     /map="14"
     gene            1..893
                     /gene="CLDN5"
                     /note="claudin 5"
                     /db_xref="GeneID:396997"
                     /db_xref="VGNC:VGNC:107377"
     exon            1..893
                     /gene="CLDN5"
                     /inference="alignment:Splign:2.1.0"
     CDS             101..757
                     /gene="CLDN5"
                     /codon_start=1
                     /product="claudin-5"
                     /protein_id="NP_001155108.1"
                     /db_xref="GeneID:396997"
                     /db_xref="VGNC:VGNC:107377"
                     /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPGKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWLCAGRPDLGFPVKYSAPRRPTATGDYDKKNYV"
     misc_feature    113..640
                     /gene="CLDN5"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
tcgaggctgtgctgagaagccgcgggtccgggggactgagggagtgagccgtgcgcgcccggaggccccgggccgtcgggcgcgcgtcttgtctccagccatgggttcggcagcgctggaaatcctcggcctcgtgctgtgcctggtgggctgggtaggcctgatcctggcgtgcgggctgcccatgtggcaggtaaccgccttcctggaccacaacatcgtgacggcgcagaccacttggaaggggctgtggatgtcctgcgtggtgcagagcacggggcatatgcagtgcaaggtgtacgactcggtgctggcgctgagcaccgaagtgcaggcagcgcgggccctcaccgtcggcgcagtgctgctggcgctcgttgcgctcttcgtgaccttggcaggtgcgcagtgcaccacctgcgtggcccccggcccgggcaaggcacgcgtagctctcacaggcggcgcgctctacgcgctctgcgggctgctggcgctcgtgccactctgctggttcgccaacatcgtggtccgcgagttctacgacccgactgtgcccatgtcgcagaagtacgagctgggcgccgccctctacatcggctgggccgcctcggcgctgctcatgtgtggaggcggcctcgtgtgctgtggtgcctggctctgtgccggccgccccgacctcggcttccctgtcaagtattcggccccgcggcggcccacggccaccggcgactacgacaagaagaactacgtctgagggtgtcgggcacaacagggccgcgagctggactagccagaggaactccgctttggagggcggccttcgctggagtgcgcggcgcactggctccgcagaactcccagctctgtgcccagaccagactttgcccgca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]