GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 22:56:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001085813             990 bp    mRNA    linear   VRT 22-MAY-2022
DEFINITION  Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA.
ACCESSION   NM_001085813
VERSION     NM_001085813.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 990)
  AUTHORS   Tseng HT, Shah R and Jamrich M.
  TITLE     Function and regulation of FoxF1 during Xenopus gut development
  JOURNAL   Development 131 (15), 3637-3647 (2004)
   PUBMED   15229177
REFERENCE   2  (bases 1 to 990)
  AUTHORS   Newman CS, Grow MW, Cleaver O, Chia F and Krieg P.
  TITLE     Xbap, a vertebrate gene related to bagpipe, is expressed in
            developing craniofacial structures and in anterior gut muscle
  JOURNAL   Dev Biol 181 (2), 223-233 (1997)
   PUBMED   9013932
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U75487.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U75487.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012418, SAMD00012419
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..990
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="1S"
                     /map="1S"
     gene            1..990
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="NK3 homeobox 2 S homeolog"
                     /db_xref="GeneID:378569"
                     /db_xref="Xenbase:XB-GENE-876836"
     CDS             1..990
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="bagpipe homeobox protein homolog 1; bagpipe
                     homeobox homolog 1"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.2"
                     /protein_id="NP_001079282.1"
                     /db_xref="GeneID:378569"
                     /db_xref="Xenbase:XB-GENE-876836"
                     /translation="
MFRGPLDTPWAADVSPSGPRGIKAGRSALLVPILGSIWGAWRPEPGATRYRTLDPMAAVRSSSRLTPFSIQAILNRKEERAHTFPRLATAVSPACCWRIFGESEAEGLGSPCGGAPGAGAGGEPSGWDSDSALSEEGELGRPGDIGERKKQRPLEARAKGEDEEETPGCSDCEIGASVPDPSPPDEDPKCEQLMLEPPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMATDLLAAAPAAKKVAVKVLVRDDQRQYHPGEVLHPSLLPLQAPYFYPYYCALPGWTLSAAACSRGTP"
     misc_feature    319..564
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="propagated from UniProtKB/Swiss-Prot (P70061.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(607..621,625..627,676..678,694..696,733..735,
                     739..744,751..756,760..768,772..777)
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    613..777
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:395001"
     misc_feature    order(613..615,622..624,742..744,751..756,763..765)
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..538
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /inference="alignment:Splign:2.1.0"
     exon            539..990
                     /gene="nkx3-2.S"
                     /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgttcagaggccctctggataccccctgggcagcagatgtttcccccagtggcccacgcgggatcaaggctggacgctctgccctgctagtgcccatcttgggatccatttggggagcttggcgcccagagccaggagccacccggtaccggacactggatccaatggcagctgtgcgaagttccagcaggctgactccattctctatccaggctattctgaacaggaaagaggagcgtgcccacacgttccccaggctggccactgcagtctcacccgcctgttgctggaggatctttggggagagtgaagcagaaggactgggctccccatgtggaggggcccctggggcaggagccgggggagagccatccgggtgggactcggattcagccctcagtgaggagggagaactgggaaggccgggggatatcggggagaggaagaagcagaggccgctggaggccagagccaagggggaggatgaggaggaaaccccaggctgcagcgactgcgagataggagccagtgtcccagatcccagccctccagatgaggatcccaagtgtgagcagctgatgctagagccccccaagcagagaaagaagcgctcccgggctgcattctcccatgcccaggtctttgagctggagagacgcttcaaccaccagcgatacttgtctggccctgagcgagctgacctggctgcctcccttaaactaacagagacccaggtgaagatatggttccagaacaggcgctacaagaccaagcgcaggcagatggctaccgaccttcttgctgcagcccctgcagcaaagaaagttgctgtgaaagtgctggtgagggacgatcagagacagtaccatcctggggaggtccttcacccttcactgcttccccttcaggccccttatttctacccttattattgtgccctgcctggctggacgctctccgcagctgcctgcagtagggggacgccataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]