2024-04-25 18:56:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001081569 768 bp mRNA linear PRI 20-JUN-2021 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ977326.1. On Feb 17, 2007 this sequence version replaced XM_001153123.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN01120800, SAMN01120804 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..768 /organism="Pan troglodytes" /mol_type="mRNA" /db_xref="taxon:9598" /chromosome="2B" /map="2B" gene 1..768 /gene="HOXD4" /note="homeobox D4" /db_xref="GeneID:739805" /db_xref="VGNC:VGNC:1966" CDS 1..768 /gene="HOXD4" /note="homeo box D4" /codon_start=1 /product="homeobox protein Hox-D4" /protein_id="NP_001075038.1" /db_xref="GeneID:739805" /db_xref="VGNC:VGNC:1966" /translation="
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL"
misc_feature 91..384 /gene="HOXD4" /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 397..414 /gene="HOXD4" /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1); Region: Antp-type hexapeptide" misc_feature order(463..477,481..483,532..534,550..552,589..591, 595..600,607..612,616..624,628..633) /gene="HOXD4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 469..630 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(469..471,478..480,598..600,607..612,619..621) /gene="HOXD4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 634..765 /gene="HOXD4" /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 1..433 /gene="HOXD4" /inference="alignment:Splign:2.1.0" exon 434..768 /gene="HOXD4" /inference="alignment:Splign:2.1.0" ORIGIN
atggtcatgagttcgtatatggtgaactccaagtatgtggaccccaagttccctccgtgcgaggagtatttgcagggcggctacctaggcgagcagggcgccgactactacggcggcggcgcgcagggcgcagacttccagcccccggggctctacccacggcccgacttcggtgagcagcctttcggaggcagcggccccgggcctggctcggcgctgcctgcgcggggtcacggacaagagccaggcggccccggcggtcactacgccgctccaggagagccttgcccagctcccccggcgcctccgccggcgcccctgcctggcgcccgggcctgcagtcagtccgaccccaagcagccgccccccgggacggcactcaagcagccggccgtggtctacccctggatgaagaaggtgcacgtgaattcggtgaaccccaactacaccggtggggaacccaagcggtcccgaacggcctacacccggcagcaagtcctagaactggaaaaagaatttcattttaacaggtatctgacaaggcgccgtcggattgaaatcgctcacaccctgtgtctgtcggagcgccagatcaagatctggttccagaaccggaggatgaagtggaaaaaagatcataagctgcccaacactaaaggcaggtcatcgtcctcatcttcctcctcatcttgctcctcctcagtcgcccccagccagcatttacagccgatggccaaagaccaccacacggacctgacgaccttatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]