GGRNA ver.2 Help | Advanced search | English    旧バージョン

2026-06-21 23:01:02, GGRNA : RefSeq release 233 (Jan, 2026)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Sugiyamaella lignohabitans Ca(2+)-dependent cysteine protease MCA1 (MCA1), partial mRNA. (1257 bp)
GO_function: GO:0004197 - cysteine-type endopeptidase activity [Evidence IEA]; GO_function: GO:0008234 - cysteine-type peptidase activity [Evidence IEA]; GO_function: GO:0016787 - hydrolase activity [Evidence IEA]; GO_function: GO:0008233 - peptidase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IDA] [PMID 11983181]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 16170310]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 16301538]; GO_process: GO:0006515 - misfolded or...
XM_018879502.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Bxi1p (BXI1), partial mRNA. (801 bp)
mitochondrion [Evidence IEA]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 21673659]; GO_component: GO:0005774 - vacuolar membrane [Evidence IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 21673659]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 21673967]; GO_process: GO:0019722 - calcium-mediated signaling [Evidence IMP] [PMID 21673967]; GO_process: GO:0030968 -...
XM_018880881.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Nma111p (NMA111), partial mRNA. (3219 bp)
activity [Evidence IEA]; GO_function: GO:0008236 - serine-type peptidase activity [Evidence IEA]; GO_function: GO:0008236 - serine-type peptidase activity [Evidence ISS] [PMID 14534547]; GO_function: GO:0008236 - serine-type peptidase activity [Evidence IDA] [PMID 18946088]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP,ISS] [PMID 14657274]; GO_process: GO:0006915 - apoptotic process [Evidence IMP,ISS] [PMID 16470384]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 16608876]; GO_process: GO:0044255 -...
XM_018882683.1 - Sugiyamaella lignohabitans - NCBI
Saccharomyces cerevisiae S288C arginyltransferase (ATE1), partial mRNA. (1512 bp)
CDS 1..1512 /gene="ATE1" /locus_tag="YGL017W" /EC_number="2.3.2.8" /experiment="EXISTENCE:direct assay:GO:0004057 arginyl-tRNA--protein transferase activity [PMID:2185248]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:genetic interaction:GO:0006915 apoptotic process [PMID:40818972]" /experiment="EXISTENCE:mutant phenotype:GO:0004057 arginyl-tRNA--protein transferase activity [PMID:2185248]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:40818972]" /experiment="EXISTENCE:mutant phenotype:GO:0071596 ubiquitin-...
NM_001180882.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C Ca(2+)-dependent cysteine protease MCA1 (MCA1), partial mRNA. (1299 bp)
direct assay:GO:0004198 calcium-dependent cysteine-type endopeptidase activity [PMID:29363267|PMID:22761449]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:12062425]" /experiment="EXISTENCE:direct assay:GO:0005829 cytosol [PMID:24855027]" /experiment="EXISTENCE:direct assay:GO:0006915 apoptotic process [PMID:11983181]" /experiment="EXISTENCE:mutant phenotype:GO:0004198 calcium-dependent cysteine-type endopeptidase activity [PMID:22761449]" /experiment="EXISTENCE:mutant phenotype:GO:0006515 protein quality control for misfolded or incompletely synthesized proteins...
Synonym: YCA1
NM_001183616.3 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Madurella fahalii Cell death protease (KEX1), partial mRNA. (1962 bp)
locus_tag="MFIFM68171_05348" /note="BUSCO:EOG092623WR; COG:E,O; EggNog:ENOG503NVHT; GO_component: GO:0005802 - trans-Golgi network [Evidence IEA]; GO_function: GO:0004185 - serine-type carboxypeptidase activity [Evidence IEA]; GO_process: GO:0006508 - proteolysis [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; InterPro:IPR001563; InterPro:IPR018202; InterPro:IPR029058; MEROPS:MER0006006; PFAM:PF00450; SECRETED:SignalP(1-30)" /codon_start=1 /product="Cell death protease" /protein_id="XP_070916869.1" /db_xref="GeneID:98176091" /translation="...
XM_071060768.1 - Madurella fahalii - NCBI
Sugiyamaella lignohabitans Kex1p (KEX1), partial mRNA. (1620 bp)
hydrolase activity [Evidence IEA]; GO_function: GO:0008233 - peptidase activity [Evidence IEA]; GO_function: GO:0004185 - serine-type carboxypeptidase activity [Evidence IEA]; GO_function: GO:0004185 - serine-type carboxypeptidase activity [Evidence TAS] [PMID 8308064]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 23656787]; GO_process: GO:0006508 - proteolysis [Evidence IEA,IEA]" /codon_start=1 /product="Kex1p" /protein_id="XP_018735202.1" /db_xref="GeneID:30038086" /translation="...
XM_018882966.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Ysp2p (YSP2), partial mRNA. (2655 bp)
membrane [Evidence IEA]; GO_component: GO:0031966 - mitochondrial membrane [Evidence IEA]; GO_component: GO:0005739 - mitochondrion [Evidence IEA]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 16962064]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006915 - apoptotic process [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 16962064]" /codon_start=1 /product="Ysp2p" /protein_id="XP_018734337.1" /db_xref="GeneID:30037916" /translation="...
XM_018882808.1 - Sugiyamaella lignohabitans - NCBI
Talaromyces atroroseus Metacaspase-1A (UA08_05615), partial mRNA. (1302 bp)
Denmark" /lat_lon="55.77198 N 12.50519 E" /collection_date="17-Dec-1990" gene 1302 /locus_tag="UA08_05615" /db_xref="GeneID:31005371" CDS 1..1302 /locus_tag="UA08_05615" /note="GO_function: GO:0004197 - cysteine-type endopeptidase activity; GO_process: GO:0006508 - proteolysis; GO_process: GO:0006915 - apoptotic process" /codon_start=1 /product="Metacaspase-1A" /protein_id="XP_020118966.1" /db_xref="GeneID:31005371" /db_xref="InterPro:IPR011600" /db_xref="InterPro:IPR029030" /translation="...
XM_020267904.1 - Talaromyces atroroseus - NCBI
Talaromyces atroroseus Pheromone-processing carboxypeptidase kex1 (UA08_04313), partial mRNA. (1890 bp)
db_xref="GeneID:31004068" CDS 1..1890 /locus_tag="UA08_04313" /note="GO_component: GO:0005794 - Golgi apparatus; GO_component: GO:0016021 - integral component of membrane; GO_function: GO:0004185 - serine-type carboxypeptidase activity; GO_process: GO:0006508 - proteolysis; GO_process: GO:0006915 - apoptotic process" /codon_start=1 /product="Pheromone-processing carboxypeptidase kex1" /protein_id="XP_020120411.1" /db_xref="GeneID:31004068" /db_xref="InterPro:IPR001563" /db_xref="InterPro:IPR018202" /db_xref="InterPro:IPR029058" /translation="...
XM_020266622.1 - Talaromyces atroroseus - NCBI
Saccharomyces cerevisiae S288C Sdd2p (SDD2), partial mRNA. (438 bp)
gene="SDD2" /locus_tag="YMR074C" /db_xref="GeneID:855096" CDS 1..438 /gene="SDD2" /locus_tag="YMR074C" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:19469552]" /note="Protein with homology to human PDCD5; PDCD5 is involved in programmed cell death; N-terminal region forms a conserved triple-helix bundle structure; overproduction suppresses lethality due to expression of the dominant PET9 allele AAC2-A128P; overexpression...
NM_001182572.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C putative serine hydrolase (FSH1), partial mRNA. (732 bp)
experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0016788 hydrolase activity, acting on ester bonds [PMID:32182256]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:31363875]" /note="Lysophospholipase; hydrolyzes lysophosphatidylserine to release free fatty acid; involved in regulated cell death; localizes to both the nucleus and cytoplasm; contains a catalytic triad of Ser-His-Asp that is part of an alpha/beta hydrolase fold and a...
NM_001179179.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C peptidylprolyl isomerase CPR3 (CPR3), partial mRNA. (549 bp)
prolyl cis-trans isomerase activity [PMID:7603990]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:16823961|PMID:14576278|PMID:24769239|PMID:7603990]" /experiment="EXISTENCE:direct assay:GO:0006457 protein folding [PMID:7603990]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17881727]" /note="Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria" /codon_start=1 /product="peptidylprolyl...
Synonym: CYP3
NM_001182437.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Talaromyces atroroseus Pro-apoptotic serine protease nma111 (UA08_03328), partial mRNA. (3075 bp)
locus_tag="UA08_03328" /db_xref="GeneID:31003083" CDS 1..3075 /locus_tag="UA08_03328" /note="GO_component: GO:0005634 - nucleus; GO_function: GO:0004252 - serine-type endopeptidase activity; GO_function: GO:0005515 - protein binding; GO_process: GO:0006508 - proteolysis; GO_process: GO:0006915 - apoptotic process" /codon_start=1 /product="Pro-apoptotic serine protease nma111" /protein_id="XP_020121228.1" /db_xref="GeneID:31003083" /db_xref="InterPro:IPR001478" /db_xref="InterPro:IPR001940" /db_xref="InterPro:IPR009003" /db_xref="InterPro:IPR025926" /translation="...
XM_020265616.1 - Talaromyces atroroseus - NCBI
Ogataea parapolymorpha DL-1 Metacaspase-1 (HPODL_01251), partial mRNA. (1191 bp)
name="Russia: Moscow" gene 1191 /locus_tag="HPODL_01251" /db_xref="GeneID:25770714" CDS 1..1191 /locus_tag="HPODL_01251" /EC_number="3.4.22.-" /codon_start=1 /product="Metacaspase-1" /protein_id="XP_013933230.1" /db_xref="GeneID:25770714" /db_xref="GO:0004197" /db_xref="GO:0006508" /db_xref="GO:0006915" /translation="...
XM_014077755.1 - Ogataea parapolymorpha DL-1 - NCBI
Ogataea parapolymorpha DL-1 Fe-S cluster assembly protein DRE2 (HPODL_02151), partial mRNA. (1044 bp)
chromosome="I" /geo_loc_name="Russia: Moscow" gene 1044 /locus_tag="HPODL_02151" /db_xref="GeneID:25771606" CDS 1..1044 /locus_tag="HPODL_02151" /codon_start=1 /product="Fe-S cluster assembly protein DRE2" /protein_id="XP_013937244.1" /db_xref="GeneID:25771606" /db_xref="GO:0005758" /db_xref="GO:0006915" /translation="...
XM_014081769.1 - Ogataea parapolymorpha DL-1 - NCBI
Saccharomyces cerevisiae S288C flavin-dependent quinone reductase (LOT6), partial mRNA. (576 bp)
experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005829 cytosol [PMID:17298444]" /experiment="EXISTENCE:mutant phenotype:GO:0003955 NAD(P)H dehydrogenase (quinone) activity [PMID:17298444]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:19709309]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:17298444]" /note="FMN-dependent NAD(P)H:quinone reductase; role in apoptosis-like cell death; may be involved in quinone detoxification; expression elevated at low...
NM_001181898.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C serine-type carboxypeptidase (KEX1), partial mRNA. (2190 bp)
direct assay:GO:0000324 fungal-type vacuole [PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0004185 serine-type carboxypeptidase activity [PMID:2668738]" /experiment="EXISTENCE:direct assay:GO:0005802 trans-Golgi network [PMID:8308064]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:23656787]" /note="Cell death protease essential for hypochlorite-induced apoptosis; involved in the processing of killer toxin and alpha factor precursor; cleaves Lys and Arg residues from the C-terminus of peptides and proteins" /codon_start=1 /product="serine-type...
NM_001181068.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C Tim18p (TIM18), partial mRNA. (579 bp)
EXISTENCE:direct assay:GO:0042721 TIM22 mitochondrial import inner membrane insertion complex [PMID:10637294|PMID:10648604]" /experiment="EXISTENCE:genetic interaction:GO:0045039 protein insertion into mitochondrial inner membrane [PMID:10637294]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0006970 response to osmotic stress [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0046685 response to...
NM_001183716.4 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C Bxi1p (BXI1), partial mRNA. (894 bp)
" /experiment="EXISTENCE:direct assay:GO:0000423 mitophagy [PMID:38465853]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:21673659]" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:21673967]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:21673967|PMID:21673659]" /experiment="EXISTENCE:mutant phenotype:GO:0019722 calcium-mediated signaling [PMID:21673967]" /experiment="EXISTENCE:mutant phenotype:GO:0030968 endoplasmic reticulum unfolded protein response [PMID:21673967]" /note="Protein involved in...
Synonym: YBH3
NM_001183143.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C ADP/ATP carrier protein PET9 (PET9), partial mRNA. (957 bp)
genetic interaction:GO:0009061 anaerobic respiration [PMID:1915842]" /experiment="EXISTENCE:genetic interaction:GO:0015867 ATP transport [PMID:35127709]" /experiment="EXISTENCE:mutant phenotype:GO:0006839 mitochondrial transport [PMID:2167309]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17822411]" /experiment="EXISTENCE:mutant phenotype:GO:0009060 aerobic respiration [PMID:2167309]" /experiment="EXISTENCE:mutant phenotype:GO:0015886 heme transport [PMID:18728780]" /experiment="EXISTENCE:mutant phenotype:GO:1901612 cardiolipin binding [PMID:38839991]" /note="...
Synonym: AAC2; ANC2
NM_001178270.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C NADPH dehydrogenase (OYE3), partial mRNA. (1203 bp)
OYE3" /locus_tag="YPL171C" /gene_synonym="ZRG6" /db_xref="GeneID:855932" CDS 1..1203 /gene="OYE3" /locus_tag="YPL171C" /gene_synonym="ZRG6" /EC_number="1.6.99.1" /experiment="EXISTENCE:direct assay:GO:0003959 NADPH dehydrogenase activity [PMID:7836424]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17897954]" /note="Conserved NADPH oxidoreductase containing flavin mononucleotide (FMN); homologous to Oye2p with different ligand binding and catalytic properties; has potential roles in oxidative stress response and programmed cell death" /codon_start=1 /product="NADPH...
Synonym: ZRG6
NM_001183985.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Ogataea parapolymorpha DL-1 Pheromone-processing carboxypeptidase KEX1 (HPODL_04558), partial mRNA. (1833 bp)
db_xref="GeneID:25773986" CDS 1..1833 /locus_tag="HPODL_04558" /EC_number="3.4.16.6" /codon_start=1 /product="Pheromone-processing carboxypeptidase KEX1" /protein_id="XP_013936369.1" /db_xref="GeneID:25773986" /db_xref="GO:0004185" /db_xref="GO:0005794" /db_xref="GO:0006508" /db_xref="GO:0006915" /db_xref="GO:0016021" /translation="...
XM_014080894.1 - Ogataea parapolymorpha DL-1 - NCBI
Saccharomyces cerevisiae S288C NADPH dehydrogenase (OYE2), partial mRNA. (1203 bp)
" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:16823961|PMID:14576278]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17897954]" /note="Conserved NADPH oxidoreductase containing flavin mononucleotide (FMN); responsible for geraniol reduction into citronellol during fermentation; homologous to Oye3p with different ligand binding and catalytic properties; may be involved in sterol...
NM_001179310.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Ogataea parapolymorpha DL-1 Mitochondrial nuclease (HPODL_01466), partial mRNA. (747 bp)
Mitochondrial nuclease" /protein_id="XP_013933452.1" /db_xref="GeneID:25770927" /db_xref="GO:0003676" /db_xref="GO:0004520" /db_xref="GO:0004529" /db_xref="GO:0004540" /db_xref="GO:0005634" /db_xref="GO:0005743" /db_xref="GO:0006308" /db_xref="GO:0006310" /db_xref="GO:0006401" /db_xref="GO:0006915" /translation="MEFVSVYDRQKRNPYYVVEHITPESLKRDASGGGDRKNSVFKEDEQIPMKFRGFLRDYFRSGYDRGHQAPAADAKFSQVAMDETFYLTNMSPQVGAGFNRDYWAHFEDFVRRLTTGYGSVRVVTGPLYLPKKDPVDGKYKVTYEVIGNPPNIAVPTHFFKLIVAEKSFKRSPNSDDIAVAAFVMPNAVIPNEVPLTSFEVPVDALERSSGLEFLKMVPDNKKKQLCKEFSCNIIVREFNDTVKALPSE" misc_feature 4..660 /locus_tag="...
XM_014077977.1 - Ogataea parapolymorpha DL-1 - NCBI
Saccharomyces cerevisiae S288C ribonuclease (NUC1), partial mRNA. (990 bp)
direct assay:GO:0051607 defense response to virus [PMID:31266891]" /experiment="EXISTENCE:mutant phenotype:GO:0006309 apoptotic DNA fragmentation [PMID:22727375]" /experiment="EXISTENCE:mutant phenotype:GO:0006310 DNA recombination [PMID:8087883]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17244531]" /note="Major mitochondrial nuclease; has RNAse and DNA endo- and exonucleolytic activities; prevents genome instability by degrading extranuclear DNA sequences; roles in mitochondrial recombination, apoptosis and maintenance of polyploidy; involved in fragmentation...
NM_001181641.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) TDH2 (TDH2), partial mRNA. (999 bp)
direct assay:GO:1990841 promoter-specific chromatin binding [PMID:27184763]" /experiment="EXISTENCE:expression pattern:GO:0006094 gluconeogenesis [PMID:3905788]" /experiment="EXISTENCE:expression pattern:GO:0006096 glycolytic process [PMID:3905788]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17726063]" /experiment="EXISTENCE:mutant phenotype:GO:0072593 reactive oxygen species metabolic process [PMID:17726063]" /note="Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 2; involved in glycolysis and gluconeogenesis; tetramer that catalyzes reaction of...
Synonym: GLD2
NM_001181666.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C ribonuclease T2 (RNY1), partial mRNA. (1305 bp)
experiment="EXISTENCE:direct assay:GO:0005773 vacuole [PMID:19332891]" /experiment="EXISTENCE:direct assay:GO:0005829 cytosol [PMID:19332891|PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0009277 fungal-type cell wall [PMID:40294649]" /experiment="EXISTENCE:genetic interaction:GO:0006915 apoptotic process [PMID:19332891]" /experiment="EXISTENCE:mutant phenotype:GO:0000902 cell morphogenesis [PMID:11158587]" /experiment="EXISTENCE:mutant phenotype:GO:0004521 RNA endonuclease activity [PMID:19332891]" /experiment="EXISTENCE:mutant phenotype:GO:0006401 RNA catabolic process...
NM_001183937.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C SUMO-targeted ubiquitin ligase complex subunit SLX5 (SLX5), partial mRNA. (1860 bp)
GO:0006974 DNA damage response [PMID:11139495]" /experiment="EXISTENCE:mutant phenotype:GO:0000723 telomere maintenance [PMID:16428246]" /experiment="EXISTENCE:mutant phenotype:GO:0006511 ubiquitin-dependent protein catabolic process [PMID:26960795]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:31320817]" /experiment="EXISTENCE:mutant phenotype:GO:0006974 DNA damage response [PMID:11139495|PMID:16325482]" /experiment="EXISTENCE:physical interaction:GO:0032183 SUMO binding [PMID:17728242]" /note="Subunit of the Slx5-Slx8 SUMO-targeted Ub ligase (STUbL) complex;...
Synonym: HEX3; ULS2
NM_001180072.3 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) TDH3 (TDH3), partial mRNA. (999 bp)
experiment="EXISTENCE:direct assay:GO:1904408 melatonin binding [PMID:31708896]" /experiment="EXISTENCE:expression pattern:GO:0006094 gluconeogenesis [PMID:3905788]" /experiment="EXISTENCE:expression pattern:GO:0006096 glycolytic process [PMID:3905788]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17726063]" /experiment="EXISTENCE:mutant phenotype:GO:0015886 heme transport [PMID:27247412]" /experiment="EXISTENCE:mutant phenotype:GO:0020037 heme binding [PMID:30012884]" /experiment="EXISTENCE:mutant phenotype:GO:0072593 reactive oxygen species metabolic process...
Synonym: GLD1; HSP35; HSP36; SSS2
NM_001181321.3 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C putative metalloreductase (AIM14), partial mRNA. (1713 bp)
gene="AIM14" /locus_tag="YGL160W" /gene_synonym="YNO1" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0097038 perinuclear endoplasmic reticulum [PMID:22586098]" /experiment="EXISTENCE:genetic interaction:GO:0006915 apoptotic process [PMID:22586098]" /experiment="EXISTENCE:mutant phenotype:GO:0016175 superoxide-generating NAD(P)H oxidase activity [PMID:22586098]" /experiment="EXISTENCE:mutant phenotype:GO:0032956 regulation of actin cytoskeleton organization [PMID:22586098]" /note="NADPH oxidase localized to the...
Synonym: YNO1
NM_001181025.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C porin POR1 (POR1), partial mRNA. (852 bp)
phospholipid scramblase activity [PMID:38065946]" /experiment="EXISTENCE:direct assay:GO:0048039 ubiquinone binding [PMID:38906315|PMID:28051849]" /experiment="EXISTENCE:mutant phenotype:GO:0005741 mitochondrial outer membrane [PMID:38065946]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17822411]" /experiment="EXISTENCE:mutant phenotype:GO:0007005 mitochondrion organization [PMID:11488609]" /experiment="EXISTENCE:mutant phenotype:GO:0042307 positive regulation of protein import into nucleus [PMID:29359182]" /experiment="EXISTENCE:mutant phenotype:GO:0045332...
Synonym: OMP2
NM_001182894.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Sugiyamaella lignohabitans Lot6p (LOT6), partial mRNA. (609 bp)
; GO_function: GO:0003955 - NAD(P)H dehydrogenase (quinone) activity [Evidence IDA,IMP] [PMID 17298444]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0008134 - transcription factor binding [Evidence IDA] [PMID 19029946]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 19709309]; GO_process: GO:0034599 - cellular response to oxidative stress [Evidence IMP] [PMID 17298444]; GO_process: GO:0042994 - cytoplasmic sequestering of transcription factor [Evidence IDA] [PMID 19029946]; GO_process: GO:0055114 - oxidation-reduction...
XM_018877915.1 - Sugiyamaella lignohabitans - NCBI
Saccharomyces cerevisiae S288C survivin (BIR1), partial mRNA. (2865 bp)
EXISTENCE:direct assay:GO:0051233 spindle midzone [PMID:16381814]" /experiment="EXISTENCE:genetic interaction:GO:0000776 kinetochore [PMID:10557299]" /experiment="EXISTENCE:mutant phenotype:GO:0000022 mitotic spindle elongation [PMID:16381814]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:16608876]" /experiment="EXISTENCE:mutant phenotype:GO:0007059 chromosome segregation [PMID:10557299]" /experiment="EXISTENCE:mutant phenotype:GO:0007094 mitotic spindle assembly checkpoint signaling [PMID:22908045]" /experiment="EXISTENCE:mutant phenotype:GO:0031134 sister...
NM_001181746.3 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Sugiyamaella lignohabitans Oye2p (OYE2), partial mRNA. (540 bp)
activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye2p" /protein_id="XP_018733977.1" /db_xref="GeneID:30036434" /translation="...
XM_018881382.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Oye2p (OYE2), partial mRNA. (600 bp)
activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye2p" /protein_id="XP_018733976.1" /db_xref="GeneID:30036433" /translation="...
XM_018881381.1 - Sugiyamaella lignohabitans - NCBI
Saccharomyces cerevisiae S288C kleisin alpha (MCD1), partial mRNA. (1701 bp)
GO:0030892 mitotic cohesin complex [PMID:9990856]" /experiment="EXISTENCE:genetic interaction:GO:0006974 DNA damage response [PMID:27325700]" /experiment="EXISTENCE:mutant phenotype:GO:0006302 double-strand break repair [PMID:11448778|PMID:23178808]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:18321989]" /experiment="EXISTENCE:mutant phenotype:GO:0006974 DNA damage response [PMID:18614046]" /experiment="EXISTENCE:mutant phenotype:GO:0007076 mitotic chromosome condensation [PMID:9335334]" /experiment="EXISTENCE:mutant phenotype:GO:0034087 establishment of mitotic...
Synonym: PDS3; RHC21; SCC1
NM_001180062.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Sugiyamaella lignohabitans Dre2p (DRE2), partial mRNA. (924 bp)
GO:0009055 - electron carrier activity [Evidence IEA]; GO_function: GO:0009055 - electron carrier activity [Evidence IMP] [PMID 20802492]; GO_function: GO:0051536 - iron-sulfur cluster binding [Evidence IEA,IEA]; GO_function: GO:0046872 - metal ion binding [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IEA,IEA]; GO_process: GO:0010421 - hydrogen peroxide-mediated programmed cell death [Evidence IEA]; GO_process: GO:0016226 - iron-sulfur cluster assembly [Evidence IEA,IEA]; GO_process: GO:0016226 - iron-sulfur cluster assembly [Evidence IMP] [PMID 18625724]; GO_process: GO...
XM_018880610.1 - Sugiyamaella lignohabitans - NCBI
Saccharomyces cerevisiae S288C separase (ESP1), partial mRNA. (4893 bp)
mitotic spindle elongation [PMID:18430955]" /experiment="EXISTENCE:mutant phenotype:GO:0000070 mitotic sister chromatid segregation [PMID:9635435]" /experiment="EXISTENCE:mutant phenotype:GO:0004197 cysteine-type endopeptidase activity [PMID:11081626]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:18321989]" /experiment="EXISTENCE:mutant phenotype:GO:0007135 meiosis II [PMID:11081626]" /experiment="EXISTENCE:mutant phenotype:GO:0031536 positive regulation of exit from mitosis [PMID:14551257|PMID:27418100]" /experiment="EXISTENCE:mutant phenotype:GO:0032888...
NM_001181227.3 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288C Rho family GTPase RHO5 (RHO5), partial mRNA. (996 bp)
experiment="EXISTENCE:genetic interaction:GO:0106071 positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway [PMID:40924759]" /experiment="EXISTENCE:mutant phenotype:GO:0003924 GTPase activity [PMID:40924759]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:18216266]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:18216266]" /experiment="EXISTENCE:mutant phenotype:GO:0106071 positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway...
Synonym: YNS0
NM_001183018.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Sugiyamaella lignohabitans ADP/ATP carrier protein PET9 (PET9), partial mRNA. (873 bp)
GO:0015866 - ADP transport [Evidence IDA] [PMID 8476415]; GO_process: GO:0015867 - ATP transport [Evidence IDA] [PMID 8476415]; GO_process: GO:0009060 - aerobic respiration [Evidence IMP] [PMID 2167309]; GO_process: GO:0009061 - anaerobic respiration [Evidence IGI] [PMID 1915842]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17822411]; GO_process: GO:0015886 - heme transport [Evidence IMP,IPI] [PMID 18728780]; GO_process: GO:0006839 - mitochondrial transport [Evidence IMP] [PMID 2167309]; GO_process: GO:0055085 - transmembrane transport [Evidence IEA]; GO_process: GO...
XM_018881652.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Oye3p (OYE3), partial mRNA. (1107 bp)
activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye3p" /protein_id="XP_018733801.1" /db_xref="GeneID:30036226" /translation="...
XM_018881186.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Oye3p (OYE3), partial mRNA. (1110 bp)
activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye3p" /protein_id="XP_018737517.1" /db_xref="GeneID:30034596" /translation="...
XM_018879618.1 - Sugiyamaella lignohabitans - NCBI
Saccharomyces cerevisiae S288C Nma111p (NMA111), partial mRNA. (2994 bp)
GO:0008236 serine-type peptidase activity [PMID:18946088]" /experiment="EXISTENCE:mutant phenotype:GO:0004252 serine-type endopeptidase activity [PMID:29861160]" /experiment="EXISTENCE:mutant phenotype:GO:0006629 lipid metabolic process [PMID:16470384]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:14657274|PMID:16470384|PMID:16608876]" /experiment="EXISTENCE:mutant phenotype:GO:0030163 protein catabolic process [PMID:18946088]" /experiment="EXISTENCE:mutant phenotype:GO:0033554 cellular response to stress [PMID:29861160]" /experiment="EXISTENCE:mutant phenotype:GO...
Synonym: YNM3
NM_001182961.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD
Sugiyamaella lignohabitans Nuc1p (NUC1), partial mRNA. (942 bp)
process [Evidence IDA] [PMID 3286639]; GO_process: GO:0006310 - DNA recombination [Evidence IMP] [PMID 8087883]; GO_process: GO:0006401 - RNA catabolic process [Evidence IDA] [PMID 3286639]; GO_process: GO:0006309 - apoptotic DNA fragmentation [Evidence IMP] [PMID 22727375]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17244531]" /codon_start=1 /product="Nuc1p" /protein_id="XP_018737496.1" /db_xref="GeneID:30034572" /translation="...
XM_018879594.1 - Sugiyamaella lignohabitans - NCBI
Ogataea parapolymorpha DL-1 Pro-apoptotic serine protease NMA111 (HPODL_02904), partial mRNA. (2931 bp)
HPODL_02904" /db_xref="GeneID:25772351" CDS 1..2931 /locus_tag="HPODL_02904" /EC_number="3.4.21.-" /codon_start=1 /product="Pro-apoptotic serine protease NMA111" /protein_id="XP_013932707.1" /db_xref="GeneID:25772351" /db_xref="GO:0004252" /db_xref="GO:0005634" /db_xref="GO:0006508" /db_xref="GO:0006915" /translation="...
XM_014077232.1 - Ogataea parapolymorpha DL-1 - NCBI
Sugiyamaella lignohabitans glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) TDH3 (TDH3), partial mRNA. (1014 bp)
(phosphorylating) activity [Evidence IDA] [PMID 3905788]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA]; GO_function: GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17726063]; GO_process: GO:0006094 - gluconeogenesis [Evidence IEP] [PMID 3905788]; GO_process: GO:0006006 - glucose metabolic process [Evidence IEA]; GO_process: GO:0006096 - glycolytic process [Evidence IEA,IEA]; GO_process: GO:0006096 - glycolytic process...
XM_018879559.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Oye2p (OYE2), partial mRNA. (1095 bp)
activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye2p" /protein_id="XP_018735413.1" /db_xref="GeneID:30032992" /translation="...
XM_018878073.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Rny1p (RNY1), partial mRNA. (1269 bp)
nuclease activity [Evidence IEA]; GO_function: GO:0033897 - ribonuclease T2 activity [Evidence IEA,IEA]; GO_process: GO:0006401 - RNA catabolic process [Evidence IMP] [PMID 19332891]; GO_process: GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic [Evidence IEA,IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IGI] [PMID 19332891]; GO_process: GO:0000902 - cell morphogenesis [Evidence IMP] [PMID 11158587]; GO_process: GO:0090305 - nucleic acid phosphodiester bond hydrolysis [Evidence IEA]" /codon_start=1 /product="Rny1p" /protein_id="XP_018735805.1" /db_xref="GeneID...
XM_018878509.1 - Sugiyamaella lignohabitans - NCBI
Sugiyamaella lignohabitans Bir1p (BIR1), partial mRNA. (2160 bp)
; GO_component: GO:0005819 - spindle [Evidence IDA] [PMID 16381814]; GO_component: GO:0051233 - spindle midzone [Evidence IDA] [PMID 16381814]; GO_function: GO:0046872 - metal ion binding [Evidence IEA]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 16608876]; GO_process: GO:0007049 - cell cycle [Evidence IEA]; GO_process: GO:0051301 - cell division [Evidence IEA]; GO_process: GO:0007059 - chromosome segregation [Evidence IMP] [PMID 10557299]; GO_process: GO:0000022 - mitotic spindle elongation...
XM_018882432.1 - Sugiyamaella lignohabitans - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : https://172.18.8.233:20082/ja/GO%3a0006915
lang : ja | div : | spe : | query_string : GO:0006915 | format : html | download :

0.000 | 0.000 | search_start;
0.246 | 0.246 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:GO%5c%3a0006915)%7C(nt:GO%5c%3a0006915)%7C(aa:GO%5c%3a0006915))?to=0&format=json
0.303 | 0.057 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:GO%5c%3a0006915)%7C(nt:GO%5c%3a0006915)%7C(aa:GO%5c%3a0006915))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.307 | 0.004 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]