2024-05-19 03:59:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021480895 1047 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio si:dkeyp-2e4.7 (si:dkeyp-2e4.7), transcript variant X1, mRNA. ACCESSION XM_021480895 VERSION XM_021480895.1 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007124.7) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1047 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="13" gene 1..1047 /gene="si:dkeyp-2e4.7" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:108191950" /db_xref="ZFIN:ZDB-GENE-061009-51" CDS 155..859 /gene="si:dkeyp-2e4.7" /codon_start=1 /product="zinc finger protein 626-like" /protein_id="XP_021336570.1" /db_xref="GeneID:108191950" /db_xref="ZFIN:ZDB-GENE-061009-51" /translation="
MKPVIKNEESLQGDPESKSTNNDVETLVLSKTEGSAALFCRRLKYRVKTDETSDQSSSDTDTEDELPISTSPTPGEDFIMRIHTGEAPYVCELCGKAFKRKHWLKEHFYIHTGVKRKRKKRLSCDQCEMKFECSSVLQGHLNKHRGERPFACVQCDKTYFNQHDLNQHLRDCHSEKKHGCYLCGNEFSRRSLLQKHMRIHTGERPYSCPHCEKTFPYKYSFEMHVKGAVCRRDK"
misc_feature 425..487 /gene="si:dkeyp-2e4.7" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 524..586 /gene="si:dkeyp-2e4.7" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature <590..832 /gene="si:dkeyp-2e4.7" /note="Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]; Region: SFP1; COG5189" /db_xref="CDD:227516" misc_feature 608..670 /gene="si:dkeyp-2e4.7" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(623..625,629..631,635..637,641..646,653..658, 665..667,707..709,713..715,725..730,737..742,749..751, 791..793,797..799,803..805,809..814,821..826) /gene="si:dkeyp-2e4.7" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 692..754 /gene="si:dkeyp-2e4.7" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 731..799 /gene="si:dkeyp-2e4.7" /note="Zinc-finger double domain; Region: zf-H2C2_2; pfam13465" /db_xref="CDD:433230" misc_feature 776..832 /gene="si:dkeyp-2e4.7" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN
aaactgcaaaaaagcactggaagaccctcttaaagacctgcggatggcagcaaagcgcctttatgagtcaagtctgcccaaatatcagaagaagaagaagatcgtacaaaacaggacatggcatatgtttgcttgaagtccggactgcatcaatatgaagcctgtgatcaaaaatgaagagtctcttcagggagatccagagtccaaatccactaataatgatgtggaaactttggttctgagtaaaacagaaggatcggctgctctcttttgcagacggctgaaatatcgagtaaaaactgatgaaacatcagatcaaagttcatcagatactgacacagaagatgagcttcccatctccacatctccaactcctggtgaagacttcatcatgcgaatacacacaggagaagcgccctatgtctgtgaactctgtggtaaagcgttcaaacgtaaacactggcttaaagaacacttttacatccatactggtgtcaaacgcaagcgcaagaagagattgagctgtgatcagtgtgaaatgaagtttgagtgctcctctgttcttcaaggtcatttaaataagcacagaggcgagaggccgttcgcctgcgttcagtgcgacaaaacctacttcaatcaacatgatcttaatcaacacctcagagactgtcattcagaaaaaaagcacggctgctatttgtgtggaaatgaattttctcgccgctctttactgcagaaacacatgcggatccacacaggagagagaccttactcctgtccacactgtgagaagactttcccctataaatacagctttgaaatgcatgttaaaggtgctgtatgtaggagagataaatgagatattgtagtacaaatgaaaaatacggaaaaatattcactttgtctctcctatgatgactccatgcaagttgccagattgacgacaatctagttttacactgtgaactgctcagctacttgctgtgtttgtaatatttatattgtttgttaattaaaaaccaccttgtggatttttacaactctgaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]