2024-11-01 10:21:17, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_021474553 1304 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio expressed sequence CO360592 (gb:co360592), transcript variant X5, mRNA. ACCESSION XM_021474553 VERSION XM_021474553.1 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018395365.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1304 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="24" /map="unlocalized" gene 1..1304 /gene="gb:co360592" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, and 72% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:558891" /db_xref="ZFIN:ZDB-GENE-071015-3" CDS 725..1249 /gene="gb:co360592" /codon_start=1 /product="uncharacterized protein C11orf65 homolog isoform X1" /protein_id="XP_021330228.1" /db_xref="GeneID:558891" /db_xref="ZFIN:ZDB-GENE-071015-3" /translation="
MPYCTELQPCDWLIRNLHERAVGQVYLIKWPFSTSEDPIFKLTEDTKKTEFHHCKIRRQQDVARKKKMRKIEWMRKMYAEGRTGHSKTAQQLQNSPETLLDSFETSDFEQEVDELLAWTRALDFDDYINEWRNLGTSRCYIVDKDELSVDVQRDFGICKISPLRQDESQHLDLI"
misc_feature <818..1135 /gene="gb:co360592" /note="chromosome 11 open reading frame 65 and homologs; Region: C11orf65; cd21090" /db_xref="CDD:411042" ORIGIN
gtttgtggaaatgtagttgaaacgattttgtttgtttttcgatattcagcgcatgggattgatctgaaatgtatgtttacatctaacgttaagggctttatttacaccgcctcagatttaattacatattttattcccctaacgttactgcctaaatctttcattcggctatattttctataagcctgaatctgtttgttgattatgtgaagacgtctccagagatcaacacgtgctagcatgagcaagaaaatgactgaacacgaatactccattgacaggcatcaccccgcatctccagctgaggaaaccacatcacagactaatgtcattcttgtcccacagctggaagcagagttcagccgagcagccatgatcatccagagagcttggagaaaacatgttgatactgctgttttcaagcacctcaagaagcttctgagcttccataatcaaggggatccacgtctcctccttagatttattaaccctgctgaggctaatattctggatgctgcttcaggggctcttatcagattccgattgggtgggtccccttattaaaccaaggttgtcacagcggaatgaaccaccaacttatccaacacatgtcttacgcagcggatgcccttccagctgcaaaccatcactgggaaaatgccccattaaatcaccattctgatgctcggtttgaactgcagcagatcgtcttgaccatgtctacatgccttactgcactgagttgcagccatgtgattggctgattagaaatttgcatgaacgagcagttggacaggtgtacctaataaagtggccattttccacgtctgaagacccaatcttcaaactaactgaagataccaagaagacagaattccatcactgcaaaatccgccggcagcaagatgttgctagaaaaaagaagatgcggaaaattgaatggatgaggaaaatgtatgcggaaggccgtacaggacacagtaaaacagcacaacagcttcagaattccccagagacattgttagattcatttgaaacttccgactttgagcaggaagtggatgagctgctagcgtggaccagagctcttgattttgatgactatattaatgaatggaggaatttgggcaccagcagatgttacatagttgacaaagatgagctttctgtggatgttcagcgagactttggtatatgtaagatttctccgctcagacaggatgagagtcaacatctggatctcatctgagagtttttactcatttgatttattaatttgaataaattaaaaagttctgaatcat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]