LOCUS       XM_021472265             651 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio C-type lectin domain family 4 member F-like
            (LOC110437865), mRNA.
ACCESSION   XM_021472265
VERSION     XM_021472265.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018394784.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="10"
                     /map="unlocalized"
     gene            1..651
                     /gene="LOC110437865"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:110437865"
     CDS             1..651
                     /gene="LOC110437865"
                     /codon_start=1
                     /product="C-type lectin domain family 4 member F-like"
                     /protein_id="XP_021327940.1"
                     /db_xref="GeneID:110437865"
                     /translation="

MSQPIYASINTNSRLKMDRSSHRNQTVIVLSVFIYTNNKNCAKDRRQLVTNISNLTGAKDELTNLLMERDQLIKQLQIFGQEAVWFYYQSSFYYLSNETKSWTESRRCCKDRGADLIIVNNKQEQDFIMKITGNNEFWIGLTDSDEEGNWKWVDGSILTSGFWASSGSITEPNGRETENCAVTHLKKHPELKGWLDVACDDAHQWICEKSILPVTI"

     misc_feature    253..627
                     /gene="LOC110437865"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in human dendritic cell (DC)-specific intercellular
                     adhesion molecule 3-grabbing non-integrin (DC-SIGN) and
                     the related receptor, DC-SIGN receptor (DC-SIGNR); Region:
                     CLECT_DC-SIGN_like; cd03590"
                     /db_xref="CDD:153060"
     misc_feature    order(406..408,511..513,517..519,532..534,562..567,
                     583..594)
                     /gene="LOC110437865"
                     /note="carbohydrate binding site; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(427..429,439..441,532..537)
                     /gene="LOC110437865"
                     /note="calcium binding site 1 [ion binding]; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(439..441,535..537)
                     /gene="LOC110437865"
                     /note="calcium binding site 3 [ion binding]; other site"
                     /db_xref="CDD:153060"
ORIGIN      

atgtctcagcctatttatgccagcataaacacaaattcaagactgaagatggacaggtcctctcatagaaatcaaacagtcatagtgctgagtgtcttcatctatacaaacaacaaaaactgtgctaaagataggcgccagctagtaaccaacatcagcaacctcacaggagccaaagatgagctaacaaaccttctgatggaaagagaccaactaataaagcaacttcagatttttggtcaagaagctgtatggttttactatcaatccagtttttactacttgtccaatgaaacaaagagctggactgagagcagaagatgctgtaaagacagaggagcagatctgatcatcgtaaacaacaaacaggaacaagattttattatgaagatcactggtaacaatgaattctggattggtctgactgacagtgatgaagaaggaaattggaaatgggttgatggcagtatactgacctctgggttctgggcttcctctggatcaataactgagcccaatggacgagaaacagagaactgtgctgtgacccatttaaaaaagcaccctgagttaaagggatggcttgatgttgcatgtgatgatgctcatcaatggatctgtgagaagtccattttaccagttaccatttaa

//