GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-04 19:45:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_021471576            1205 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio putative claudin-24 (LOC110438642), mRNA.
ACCESSION   XM_021471576
VERSION     XM_021471576.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018394568.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1205
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="5"
                     /map="unlocalized"
     gene            1..1205
                     /gene="LOC110438642"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 5 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:110438642"
     CDS             293..955
                     /gene="LOC110438642"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="XP_021327251.1"
                     /db_xref="GeneID:110438642"
                     /translation="
MVLFTTKFVQRTSLFVSFGGLVTTFVTTFLPLWKTMNSDLNEMENWYEGLWHMCIYTEEVGIHCKAFDSFLALPPDTFAGRVLMCISIATGILGVAAAFFGLRGVEIGASRERMKRNLLILGGVFVVVSGVTTLAAVSFMAYVMVVKFWDDDRPEVMPGWEYGEAMFSAWFAGLLLVVGGSFLFVAVCMGDHEVKLQTEMIARCQEQRPRSLHYRKTEII"
     misc_feature    332..841
                     /gene="LOC110438642"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
ctaaacagatttctgtttcccctcgatttaaaaaaagtccaaccacactctgttcaggcttcgtacgtccagacttaaaactagacgtatcgtatttcctctcaaaaaagcagttattgtcctcggcgaagatattcatcagtttgaaaaacagtcctgccgttgtgaagggctccaggattatccagcaggaacaggtgggtttttattaaagcaaaggaggagccagacgaaaaccagaagagctgaaaatctcagatggacagacagacaaaatcagacgagaggtaatatggtgctgttcaccaccaagtttgtacagaggacttcgctctttgtgtccttcggaggtttggtcacaacgttcgtcacaaccttcttgcctctatggaagacgatgaactccgatttgaatgaaatggagaactggtacgagggtctctggcacatgtgtatctacacggaggaagttggcatccattgcaaagcctttgattctttcttagctcttccgccggacactttcgctggccgggttctcatgtgcatttccatcgccactggaattctcggtgtggcggctgcttttttcggactccgcggagttgagattggagccagtcgagagaggatgaagaggaatctgctgatcctcgggggagtttttgtagttgtgtctggagtcacgactcttgcggctgtttcatttatggcgtatgttatggttgtgaaattctgggatgatgatcgtcctgaagtcatgcccggatgggagtatggagaagccatgttttctgcctggtttgctggacttctgttagttgtcggagggagttttttgtttgttgcagtctgcatgggcgatcatgaagtgaagctgcaaactgaaatgattgcacgctgtcaagaacagcggccgagatctctgcattaccgaaagacggaaatcatatagctttgatttttgtctgaagatcggaaaaaaatcgaagcttaactaaacaaagttgctgaacttttgaaatattgaacttgttttaatcggaactataatatcttgtggtgattttgttttataatccgctctcaagtaaattgaaagaaagttgaagtcaacatctacatttttttttctcttctttttcaaatattttccaaacgatgtttaacaaagcaaggaaattttcacagtatgcctgataacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]