GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 10:34:29, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_021471218             631 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio si:dkey-27h10.2 (si:dkey-27h10.2),
            transcript variant X4, mRNA.
ACCESSION   XM_021471218
VERSION     XM_021471218.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018394497.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 4% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..631
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="unlocalized"
     gene            1..631
                     /gene="si:dkey-27h10.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 96% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:100150349"
                     /db_xref="ZFIN:ZDB-GENE-090313-296"
     CDS             1..510
                     /gene="si:dkey-27h10.2"
                     /codon_start=1
                     /product="uncharacterized protein si:dkey-27h10.2 isoform
                     X4"
                     /protein_id="XP_021326893.1"
                     /db_xref="GeneID:100150349"
                     /db_xref="ZFIN:ZDB-GENE-090313-296"
                     /translation="
MYPNIIILVIAVLCITGVVVYCCLQKNSRKYSVDLHPKKEDAQIPLSTVDAEVFDTTSEKDLQTFAPVEPVKDPDIGKEAEKPEEGKEIPDVKQENQQNLSTPEATVIPNDKKDELTVVDLTDAEPAISTKTSMESLDDTLNENNSNNTRIEGIANGYEFIEIFLDGPL"
ORIGIN      
atgtatcctaacataattattctggtcattgctgttctgtgcatcactggagtagtagtttactgctgccttcaaaagaactccaggaagtattctgtcgacttgcaccctaaaaaagaagatgctcagattccactcagcacagtggatgcagaagtgtttgacaccacgtcagaaaaagatttgcaaacatttgctccagttgagccagtaaaggaccctgacattgggaaggaagctgaaaagcctgaggaaggaaaagaaatacctgatgttaaacaagaaaaccaacagaatttgtccacccctgaggccacagtgattccaaatgacaaaaaagatgaactgactgtagtggatctgactgatgcagaaccagcgatctcaaccaaaacctcaatggaatcactagatgatactcttaatgaaaacaacagcaacaacacaagaattgaaggcattgccaatgggtatgaattcattgagatctttcttgatggtccactctaaaataaatcagctccttcccaacattttacaatgatctttgaacctgattgatggatttttgactctgcaacatggaaaacaacttcttcatttttacctgtgtgtaagtctacttttcaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]