GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 16:23:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_017354872            2557 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio GTPase IMAP family member 8-like
            (LOC108179126), mRNA.
ACCESSION   XM_017354872
VERSION     XM_017354872.2
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007114.7) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 15, 2017 this sequence version replaced XM_017354872.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2557
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="3"
     gene            1..2557
                     /gene="LOC108179126"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:108179126"
     CDS             2..2242
                     /gene="LOC108179126"
                     /codon_start=1
                     /product="GTPase IMAP family member 8-like"
                     /protein_id="XP_017210361.2"
                     /db_xref="GeneID:108179126"
                     /translation="
MCGTLGFYIWHSVGFKLLVNFTFSSLHLFVFRVDALKMREMTAGLNVVLLGKTGAGKSSSGNTILGRQAFITQKSVAQDVTVESGSFGELPVSVYDTPGLSDIEMSEEEIRQMINEKILQICSSGLCVFLLVIKADRFTEEDRKTVEKIEKILGENNQNNTWILFTRGDKLEGENMTIEKFIEETEELKTLVQKYEDRYHLFNNNKMKKEEEEEGGPSEQVKILFNKILKPYLDTMAGEKIWQQNTLKRKIPANIGAVSRVSGLPSRRIVLLGKSGVGKSAVGNTILGQKEFTSVMSTNSVTRVCSAAQSTVSGRSVSVVDTPGFFDTKMKPEELMMEIARSVYISSPGPHAFLIVFHVNTRFTEQEEQIPQMIELMFGEEVLKYSIILFTHGDLLDGESVEKLIEENFALRSLVQQCGGRYHVFNNKVNNREQVEDLQQKIDSMIQQNGGGHYTNQMYEDAQIFRQEEEEERKLQEEKQIQEEIEREIKETEERIKAEMEAENLKAERLSEEEQRRREKQRQEEIERVKKNTEERVRKEIKAKKETEERIRAENKAKLNEESGFLNFFSKYKHHFATAGHVVGGIAIGAAVLSGVGVGAAAGAGLAAFCAGVGSVSVAGAAVGGVVGGVVGGVAASKYEEEIKWKKRRREEEEREQQVDKKIQEEIERAIKEIDERFREEMVAKNLKAEKQSEEEQRRQEKQRLEEIKRVREKTEERIRAEIEAKKQRDGVRKNREDERNKNKRS"
     misc_feature    134..>607
                     /gene="LOC108179126"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl38936"
                     /db_xref="CDD:453896"
     misc_feature    152..175
                     /gene="LOC108179126"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    242..244
                     /gene="LOC108179126"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    287..298
                     /gene="LOC108179126"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(293..298,380..385)
                     /gene="LOC108179126"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    497..508
                     /gene="LOC108179126"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    800..1393
                     /gene="LOC108179126"
                     /note="AvrRpt2-Induced Gene 1 (AIG1); Region: AIG1;
                     cd01852"
                     /db_xref="CDD:206651"
     misc_feature    818..841
                     /gene="LOC108179126"
                     /note="G1 box; other site"
                     /db_xref="CDD:206651"
     misc_feature    order(827..844,881..883,1175..1177,1181..1183,1280..1285)
                     /gene="LOC108179126"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206651"
     misc_feature    902..925
                     /gene="LOC108179126"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206651"
     misc_feature    905..907
                     /gene="LOC108179126"
                     /note="G2 box; other site"
                     /db_xref="CDD:206651"
     misc_feature    962..973
                     /gene="LOC108179126"
                     /note="G3 box; other site"
                     /db_xref="CDD:206651"
     misc_feature    order(968..976,1004..1057)
                     /gene="LOC108179126"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206651"
     misc_feature    1172..1183
                     /gene="LOC108179126"
                     /note="G4 box; other site"
                     /db_xref="CDD:206651"
     misc_feature    1256..1264
                     /gene="LOC108179126"
                     /note="G5 box; other site"
                     /db_xref="CDD:206651"
     misc_feature    <1463..2236
                     /gene="LOC108179126"
                     /note="MAEBL; Provisional; Region: PTZ00121"
                     /db_xref="CDD:173412"
ORIGIN      
gatgtgtggcacacttggtttttacatttggcactctgtgggatttaaattactagtgaatttcactttttcatctttgcatctttttgtttttagggttgatgcattgaaaatgagagaaatgaccgccggattgaacgtggtcctgctgggaaaaacaggagccggaaaaagctcatcaggaaacacaatcctgggtcgacaagctttcatcacacagaaaagtgtcgcacaagacgtcactgtggagtctggatcattcggtgaactaccagtctctgtttacgacactccaggattatcagatatagagatgagtgaagaagagattcggcagatgatcaatgagaagatcctccaaatatgttcatcaggtctgtgtgtgtttctgctggtcatcaaagcagacagattcactgaagaagacagaaaaactgtggagaagattgagaagatcctgggagaaaacaaccagaacaacacctggattctgttcaccagaggagacaaactggagggagaaaacatgacgatagagaagttcatagaggagactgaagaactgaagacactcgtgcagaaatatgaggacagataccatctgttcaacaacaacaagatgaagaaggaggaagaggaggaggggggaccaagtgaacaagtaaagatactgttcaataaaatactgaagccttacctcgacacaatggcaggagaaaagatatggcagcagaatacactgaagagaaaaataccagcaaatattggagcagtctctcgtgtctccggtctcccctccagacggattgttcttctcggtaaatctggtgttggtaaaagtgcagttggaaacacaatcctgggacagaaagagtttacatctgtgatgagcacaaattcagtaacccgcgtttgttcagcagctcagtccacagtttcaggcagatctgtgtctgtagtcgacactcctggattctttgacacaaagatgaaacctgaagagttaatgatggagatcgccagaagtgtgtatatctccagtcctggacctcacgctttcctcattgtgtttcatgtgaacacgagattcactgaacaggaggaacagattcctcagatgattgagctgatgtttggtgaagaagtgttgaaatactccatcattctcttcactcatggagatctgctggatggcgagtcagtagagaagctgatagaggagaactttgccttaagatctctagtccagcagtgtggaggcagatatcatgtgttcaacaataaagtgaataacagagagcaggtggaggatctacagcagaagattgactcaatgatacagcagaatggaggaggacactacactaaccagatgtatgaagatgctcagatattcagacaagaggaagaagaggagagaaaactacaagaggagaaacaaatacaagaggagattgagagagagataaaggagactgaggagagaatcaaagcagaaatggaagctgaaaatcttaaagcagagagactgagtgaggaagaacagagaagacgagagaaacaaagacaagaggagatagagagagtgaagaagaatactgaggagagggttagaaaagaaattaaagctaaaaaggagacagaagagagaatcagagcagagaataaggctaaattaaatgaggagagtggctttttaaactttttttccaaatacaaacatcattttgccacggcaggacatgttgttggaggaattgctatcggagctgcagttttatctggagttggagttggagctgctgctggagctggtttagcagctttttgtgctggagtaggaagtgtttcagttgctggagctgctgttggaggtgttgttggaggtgttgttggaggtgttgctgctagcaaatatgaggaagaaataaagtggaagaagagaagaagagaagaagaagagagagaacaacaagttgacaaaaaaatacaagaagagattgagagagcaataaaggagattgatgagagattcagagaagaaatggtagctaaaaatcttaaagcagagaaacagagtgaggaagaacagagaagacaagagaaacaaagactagaggagattaagagagtaagagaaaagacagaggagagaatcagagcagaaattgaagctaaaaagcagagagacggagtaaggaagaacagagaagacgagagaaacaaaaacaagaggagttagagtgataaaagagacagaggagagagtcagagcagaaaatgaggctaaattaaacgagaagagtggatttttttatttttttaagagaggaagaagagaggaagaagagagaaaacaacaagttgacaaacaaatacaagaggagattgagagagtgataaaggagacaaaggagagatttagagaagaaatggaaactgaaaatcttaaagcagagagacagagtgaggaagaacagaaaagatgagaaaaacaaagacaagaggagatagagagagtgagaatggaaactgaggagagggtcagaacagagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]