2024-05-19 05:12:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_017354872 2557 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio GTPase IMAP family member 8-like (LOC108179126), mRNA. ACCESSION XM_017354872 VERSION XM_017354872.2 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007114.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 15, 2017 this sequence version replaced XM_017354872.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2557 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="3" gene 1..2557 /gene="LOC108179126" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:108179126" CDS 2..2242 /gene="LOC108179126" /codon_start=1 /product="GTPase IMAP family member 8-like" /protein_id="XP_017210361.2" /db_xref="GeneID:108179126" /translation="
MCGTLGFYIWHSVGFKLLVNFTFSSLHLFVFRVDALKMREMTAGLNVVLLGKTGAGKSSSGNTILGRQAFITQKSVAQDVTVESGSFGELPVSVYDTPGLSDIEMSEEEIRQMINEKILQICSSGLCVFLLVIKADRFTEEDRKTVEKIEKILGENNQNNTWILFTRGDKLEGENMTIEKFIEETEELKTLVQKYEDRYHLFNNNKMKKEEEEEGGPSEQVKILFNKILKPYLDTMAGEKIWQQNTLKRKIPANIGAVSRVSGLPSRRIVLLGKSGVGKSAVGNTILGQKEFTSVMSTNSVTRVCSAAQSTVSGRSVSVVDTPGFFDTKMKPEELMMEIARSVYISSPGPHAFLIVFHVNTRFTEQEEQIPQMIELMFGEEVLKYSIILFTHGDLLDGESVEKLIEENFALRSLVQQCGGRYHVFNNKVNNREQVEDLQQKIDSMIQQNGGGHYTNQMYEDAQIFRQEEEEERKLQEEKQIQEEIEREIKETEERIKAEMEAENLKAERLSEEEQRRREKQRQEEIERVKKNTEERVRKEIKAKKETEERIRAENKAKLNEESGFLNFFSKYKHHFATAGHVVGGIAIGAAVLSGVGVGAAAGAGLAAFCAGVGSVSVAGAAVGGVVGGVVGGVAASKYEEEIKWKKRRREEEEREQQVDKKIQEEIERAIKEIDERFREEMVAKNLKAEKQSEEEQRRQEKQRLEEIKRVREKTEERIRAEIEAKKQRDGVRKNREDERNKNKRS"
misc_feature 134..>607 /gene="LOC108179126" /note="P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl38936" /db_xref="CDD:453896" misc_feature 152..175 /gene="LOC108179126" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature 242..244 /gene="LOC108179126" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 287..298 /gene="LOC108179126" /note="G3 box; other site" /db_xref="CDD:206648" misc_feature order(293..298,380..385) /gene="LOC108179126" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 497..508 /gene="LOC108179126" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 800..1393 /gene="LOC108179126" /note="AvrRpt2-Induced Gene 1 (AIG1); Region: AIG1; cd01852" /db_xref="CDD:206651" misc_feature 818..841 /gene="LOC108179126" /note="G1 box; other site" /db_xref="CDD:206651" misc_feature order(827..844,881..883,1175..1177,1181..1183,1280..1285) /gene="LOC108179126" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206651" misc_feature 902..925 /gene="LOC108179126" /note="Switch I region; other site" /db_xref="CDD:206651" misc_feature 905..907 /gene="LOC108179126" /note="G2 box; other site" /db_xref="CDD:206651" misc_feature 962..973 /gene="LOC108179126" /note="G3 box; other site" /db_xref="CDD:206651" misc_feature order(968..976,1004..1057) /gene="LOC108179126" /note="Switch II region; other site" /db_xref="CDD:206651" misc_feature 1172..1183 /gene="LOC108179126" /note="G4 box; other site" /db_xref="CDD:206651" misc_feature 1256..1264 /gene="LOC108179126" /note="G5 box; other site" /db_xref="CDD:206651" misc_feature <1463..2236 /gene="LOC108179126" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN
gatgtgtggcacacttggtttttacatttggcactctgtgggatttaaattactagtgaatttcactttttcatctttgcatctttttgtttttagggttgatgcattgaaaatgagagaaatgaccgccggattgaacgtggtcctgctgggaaaaacaggagccggaaaaagctcatcaggaaacacaatcctgggtcgacaagctttcatcacacagaaaagtgtcgcacaagacgtcactgtggagtctggatcattcggtgaactaccagtctctgtttacgacactccaggattatcagatatagagatgagtgaagaagagattcggcagatgatcaatgagaagatcctccaaatatgttcatcaggtctgtgtgtgtttctgctggtcatcaaagcagacagattcactgaagaagacagaaaaactgtggagaagattgagaagatcctgggagaaaacaaccagaacaacacctggattctgttcaccagaggagacaaactggagggagaaaacatgacgatagagaagttcatagaggagactgaagaactgaagacactcgtgcagaaatatgaggacagataccatctgttcaacaacaacaagatgaagaaggaggaagaggaggaggggggaccaagtgaacaagtaaagatactgttcaataaaatactgaagccttacctcgacacaatggcaggagaaaagatatggcagcagaatacactgaagagaaaaataccagcaaatattggagcagtctctcgtgtctccggtctcccctccagacggattgttcttctcggtaaatctggtgttggtaaaagtgcagttggaaacacaatcctgggacagaaagagtttacatctgtgatgagcacaaattcagtaacccgcgtttgttcagcagctcagtccacagtttcaggcagatctgtgtctgtagtcgacactcctggattctttgacacaaagatgaaacctgaagagttaatgatggagatcgccagaagtgtgtatatctccagtcctggacctcacgctttcctcattgtgtttcatgtgaacacgagattcactgaacaggaggaacagattcctcagatgattgagctgatgtttggtgaagaagtgttgaaatactccatcattctcttcactcatggagatctgctggatggcgagtcagtagagaagctgatagaggagaactttgccttaagatctctagtccagcagtgtggaggcagatatcatgtgttcaacaataaagtgaataacagagagcaggtggaggatctacagcagaagattgactcaatgatacagcagaatggaggaggacactacactaaccagatgtatgaagatgctcagatattcagacaagaggaagaagaggagagaaaactacaagaggagaaacaaatacaagaggagattgagagagagataaaggagactgaggagagaatcaaagcagaaatggaagctgaaaatcttaaagcagagagactgagtgaggaagaacagagaagacgagagaaacaaagacaagaggagatagagagagtgaagaagaatactgaggagagggttagaaaagaaattaaagctaaaaaggagacagaagagagaatcagagcagagaataaggctaaattaaatgaggagagtggctttttaaactttttttccaaatacaaacatcattttgccacggcaggacatgttgttggaggaattgctatcggagctgcagttttatctggagttggagttggagctgctgctggagctggtttagcagctttttgtgctggagtaggaagtgtttcagttgctggagctgctgttggaggtgttgttggaggtgttgttggaggtgttgctgctagcaaatatgaggaagaaataaagtggaagaagagaagaagagaagaagaagagagagaacaacaagttgacaaaaaaatacaagaagagattgagagagcaataaaggagattgatgagagattcagagaagaaatggtagctaaaaatcttaaagcagagaaacagagtgaggaagaacagagaagacaagagaaacaaagactagaggagattaagagagtaagagaaaagacagaggagagaatcagagcagaaattgaagctaaaaagcagagagacggagtaaggaagaacagagaagacgagagaaacaaaaacaagaggagttagagtgataaaagagacagaggagagagtcagagcagaaaatgaggctaaattaaacgagaagagtggatttttttatttttttaagagaggaagaagagaggaagaagagagaaaacaacaagttgacaaacaaatacaagaggagattgagagagtgataaaggagacaaaggagagatttagagaagaaatggaaactgaaaatcttaaagcagagagacagagtgaggaagaacagaaaagatgagaaaaacaaagacaagaggagatagagagagtgagaatggaaactgaggagagggtcagaacagagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]