GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-11 03:58:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_017351356            2136 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio protein argonaute-3 (LOC567622), transcript
            variant X2, mRNA.
ACCESSION   XM_017351356
VERSION     XM_017351356.2
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007127.7) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 15, 2017 this sequence version replaced XM_017351356.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2136
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="16"
     gene            1..2136
                     /gene="LOC567622"
                     /gene_synonym="ago3a; eif2c1"
                     /note="protein argonaute-3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     ESTs, 4 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 19 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:567622"
     CDS             706..2136
                     /gene="LOC567622"
                     /gene_synonym="ago3a; eif2c1"
                     /codon_start=1
                     /product="protein argonaute-3 isoform X2"
                     /protein_id="XP_017206845.1"
                     /db_xref="GeneID:567622"
                     /translation="
MEIGTTGAVGAQSLFSMPRRPGYGTMGKPIKLLANCFQVEIPKMDVYLYEVDIKPEKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKKSLYTANPLPVAPAGVDLDVTLPGEGGKDRPFKVSIKFVSLVSWHLLHEVLTGRSMPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYEADPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRVSTEHFMNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILK"
     misc_feature    763..>2127
                     /gene="LOC567622"
                     /gene_synonym="ago3a; eif2c1"
                     /note="protein argonaute; Provisional; Region: PLN03202"
                     /db_xref="CDD:215631"
ORIGIN      
cggaggatcagacgctccatatttagctgcagcgagtctcgcagaggctctgagtgtttgagaaagcgggcagagagagagttctgcttccaacttactttatgtgaccactggcggaaaaccacgggaatacgcgcttataaaaagccactagagccgagagcgaaattcatggcagaccggggactttaagcgaagacacgactggatttttgtttcctctcagatgggaatgtagcttagctggttagcctggccactagcagtagcaagttagctctgtcgaagagcggaggcgacataagtggacttttacttgctataacgtcataacacctctacaaaccgccctagtctttccaaagacgtgtttctgaaggcgtcgccgtcacagaaacagagactcgggactgaatttgggctgactgagaggaacttaccgttaccgttttagctagctggctagctggccgtcacgtcaatctgtcaaccgtacccgaaatcccgaccggatagtttgagtcacataccgggcaaccaaacattatctccggtgacacacgagcctcagggaaggtggactaataccgagaggaatcgcttgcggtgggttaacgcaaccggtttgtgcggccataggacagtcagagtttctgaagttcatcaactgcgagccggggacggaaccggacagagacctcatgaatggaaatcggaactacaggagccgttggggcccagtccctgttctccatgccacggaggcccggctatggcaccatggggaaacctatcaaactgctggccaactgcttccaggtggagatcccaaagatggacgtctacctgtacgaggtggacatcaagcccgagaagtgtccacggagagtaaatagggaggtggtggactccatggtgcagcactttaaagtcaccatctttggggatcgaaggccagtttatgatgggaagaaaagtctctacaccgccaacccacttcctgtggcacctgcaggggtggatctggatgtcacgctgccaggtgaagggggcaaagaccggccctttaaagtctcaattaagtttgtgtctctggtgagctggcacctgctgcacgaggtgctaaccgggcgcagtatgccagagccgctggaactggacaagccaatcagcaccaacccagtgcacgctgtggatgtggtgctccgccatctgccctccatgaagtacacacccgtgggccgctcatttttctccgccccggagggttatgatcatcctctaggtggaggcagagaggtgtggttcggtttccatcagtctgttcggcccgccatgtggaaaatgatgctcaacattgatgtgtcagccacggctttctacaaagcacagccagtcattcagttcatgtgtgaagtcctggacatccacaacatcgacgagcagccgcgacccctcacagactcccacagagtcaaattcaccaaagaaatcaaaggtctgaaggtggaggtgacccactgcgggaccatgcggaggaagtaccgcgtctgcaatgtgacccgccggcctgccagccaccaaacgttccctttgcagttggagaacggccaaactgtagaacggacagtagctcagtatttcagagagaagtacaacctgcagctcaagtaccctcacctgccctgtctacaggtgggacaggagcagaaacacacatacctgcctctggaggtttgcaatattgtagcagggcagcggtgcatcaagaaactgacagataatcagacgtccaccatgatcaaagccacggcgcgctccgcaccagaccgacaggaggagatcagcagactggtgcgcagcgctaactatgaagccgacccgttcgtgcaggagtttcagtttaaggtccgggatgagatggcccacgtgacggggcgcgtgttgcccgcgcccatgctgcagtacgggggcagggtgagcacagagcactttatgaaccgcactgtcgccacaccgagtcacggcgtttgggacatgagaggaaagcagtttcacaccggcgtggagatcaagatgtgggccatcgcctgcttcgccacacagaggcagtgcagagaggagatcctcaagtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]